KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_208637Help
Entry
LOTGIDRAFT_208637 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00040  Pentose and glucuronate interconversions
lgi00051  Fructose and mannose metabolism
lgi01100  Metabolic pathways
Module
lgi_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LOTGIDRAFT_208637
   00051 Fructose and mannose metabolism
    LOTGIDRAFT_208637
Enzymes [BR:lgi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     LOTGIDRAFT_208637
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 AlaDh_PNT_C UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 20246077
NCBI-ProteinID: XP_009044203
JGI: 208637
UniProt: V4B572
LinkDB All DBs
Position
Unknown
AA seq 348 aa AA seqDB search
MADKNLTAILYKQGDLKLEDLPVKEPGPGQVQLSMKDVGICGSDVHYWTHGAIGDFIVKA
PMILGHEAAGVVCKLGEGVTTLKVGDRVAIEPGVPCKMCKYCKKGRYNLCPDMKFCATPP
YDGNLARFYCHDADYCYKLPDHVSNEEGALLEPLSVGVHACARAGVEIGSRVLICGAGPI
GLVNMLTAKARGAAEIIMTDIDQSRLDFAKSLGANHILKVTSRDPQVTANQIEEIMGDKV
DITIECSGAPPSIRTGIFATAPGGCVVLVGLGPADVELPIVNASVREVDIRGIFRYVNCY
PTALAMVASGQVNVKPLVTHRFKLEQALEAFQMAKEGKGVKIIINCEK
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaaaaatctaacagctattctgtacaagcagggtgacctgaaattggaagat
ctccctgtcaaagagccaggcccaggacaggtacaactgagtatgaaagatgtaggtatt
tgtggttcagacgtacactactggactcatggggctatcggagactttatcgtcaaggct
cctatgatattgggacatgaagcagcaggcgtagtctgtaaacttggagaaggagttact
actttgaaagttggagatcgtgtggctattgaaccaggggtaccatgtaagatgtgtaaa
tactgtaagaagggaagatataatctatgtccagatatgaagttctgtgctacaccacct
tatgatggaaatctagctagattctattgtcatgatgctgattactgttacaaattacca
gaccatgtgagtaatgaagaaggagctctgttagaaccactgtcagttggtgtacatgcc
tgtgcccgtgctggtgtggagattggttctagagtgttaatctgtggagctggacctatt
ggtctagttaatatgttaacagctaaagctagaggagctgctgaaattattatgactgat
atcgaccaatccagattagattttgcgaagagtttaggagcaaatcatatattaaaagta
acgagtagagatcctcaagttacagccaatcagattgaagaaataatgggtgataaagtt
gacatcactatagaatgtagcggggctcctcccagtattagaactggaatcttcgcaaca
gcacctggaggttgtgtagtattggtaggattaggaccagctgatgtagagttacctata
gttaatgctagtgttcgtgaagtagatatacgaggaatattccgttatgtcaactgttat
cctacagctctagctatggtagcatcaggacaagttaatgtgaagcctctcgtgactcac
agatttaaactggagcaggctttagaagcttttcagatggcaaaagagggaaaaggagtc
aagattattattaattgtgaaaaataa

DBGET integrated database retrieval system