KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_212916Help
Entry
LOTGIDRAFT_212916 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00052  Galactose metabolism
lgi00500  Starch and sucrose metabolism
lgi01100  Metabolic pathways
lgi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LOTGIDRAFT_212916
   00500 Starch and sucrose metabolism
    LOTGIDRAFT_212916
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    LOTGIDRAFT_212916
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgi04147]
    LOTGIDRAFT_212916
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     LOTGIDRAFT_212916
Exosome [BR:lgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOTGIDRAFT_212916
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil DUF5110 NUC129
Motif
Other DBs
NCBI-GeneID: 20246395
NCBI-ProteinID: XP_009048062
JGI: 212916
UniProt: V4AVQ0
LinkDB All DBs
Position
Unknown
AA seq 1018 aa AA seqDB search
MTKYKYSKLEDSEDGAVLDKSCDGNKSPDLPRGKKFEVHVKKVSMRNGVFCEFLIILIVF
LLCLMLIQSAFTNTCLFSKVFNYTKSSLDHKQSDLRHTPSSLNRHQSYFEIVEINIEEDV
VYQEISQNQVDEQAVVKNFQQYKTSKEKTRDKQCYIVDDGKKFDCHPEAGTTKETCEARG
CCYYPVKKYNENPPGIPYCYYPLNYPSYTVDKIENKKQGYDVFLSRKTPSYYPQDEMNLK
MEIKKETSSRLHIKISNQKEDRWEVPLPTSGSTKRDTVIQPDNEDTLYSVAVADVGQPFG
FQVNRTGDGAKNILETAGGFIFADQFLQLSYFLPSQFIYGLGEHRDSLLHSMNWTRFVLW
NRDQPPTENGNLYGSHPFYLMMENDGNSHGVLLLNSNAIEVLLQPAPAITWRSIGGVIDL
YMFLGPNPSDVIQQYTEVIGRTFMPPYWSLGFHLCRWGFHTVNETMQVVKNMSRYGIPQD
VQWNDIDYMDAKKDFTTDLKNFGDQSAMVDEFHKLGLHYIMIIDPGISSTTSPGTYHPLD
LGLEMGIFIKDINGKPIEGKVWPGNTYFPDFTHPDSQKYWTNISATFHNSVQFDGIWIDM
NEISNFVAGSINGCPTNSSLENPPYLPAINGNKLSVNTLCLTAQQYLSSQYNVHNLYGFT
ETRATHNALVSIRQKRPFVITRSTFVGSGYYGGHWSGDNYASYHDLYRSISESLSMNMFG
VTIVGADICGFRGDTTEELCTRWHQLGAFYTFSRNHNNNGNKAQDPASFGPALAKSTRKV
LLTRYTLLPYLYTLIHKSHMMGHTVMRPLFFEYPTDVTTYNIDKQFLWGPALLITPVLDE
GVRSVEGYFPKDIWYDFYTGQCIVSEGGGQILDAPLDKINLHVRGGYILPWQYANTTTTL
SRKNKFGLLVALNSSGGAEGDLFWDDGDTLDTHEKKIFNMFTFTADSKGVYVNAMYIGLS
QESMYLGDITVFGVKTKPASITVNNKAVQFVYNDQYKVLYIAGHSFDLYQPIRLLWTF
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgacgaagtataagtatagtaagctggaagattcagaagatggagctgtcttagataag
tcctgtgatggaaataaatctccagatttaccaagaggaaagaagtttgaagttcatgtc
aagaaagtcagcatgagaaatggagtattttgtgaatttttgataattttgattgtattt
ttgttgtgtttaatgttaatacaatcagcgttcacaaacacctgtttattttcaaaagtt
tttaattataccaaatcttccctcgatcacaagcaatctgatttgagacatactcctagt
tctttgaacagacaccagtcttattttgagattgttgaaataaacattgaagaagatgtg
gtctatcaagaaatcagtcaaaatcaagtagatgaacaagcagttgtcaaaaactttcaa
caatacaaaacttcaaaagaaaaaactcgagataaacaatgttatattgttgatgatggg
aagaaatttgattgtcatcctgaagcagggacaacaaaggagacatgtgaggcaagagga
tgttgttattatcctgttaagaaatataatgaaaatccaccaggcataccttactgttat
tatcctttaaactaccccagttacactgttgataaaatagaaaataaaaaacaaggttat
gatgtgtttttatccagaaaaactccttcatattaccctcaagatgaaatgaatttgaaa
atggaaatcaagaaggaaacttcatcaagacttcatattaagatcagtaatcagaaagaa
gatagatgggaagtgcccctcccaacttcaggcagtaccaagagagatactgtcattcaa
cctgacaatgaagatactctatattcagtggctgtggctgatgtaggacaaccgtttggt
ttccaagtcaatagaactggtgatggagctaaaaatatattggaaacagcaggagggttt
atatttgctgaccaatttttacagttatcctattttttgccctctcaatttatatatgga
ttaggagaacatagagattcattattacattctatgaactggacaagatttgttttgtgg
aatcgtgatcaacctcccactgaaaatggtaatttatatggaagccacccattctatctg
atgatggagaatgatggtaatagtcatggtgttttattattaaatagtaatgcaattgag
gtattattacaaccagctccagctataacatggagaagtataggtggtgtgatagattta
tacatgtttcttggacctaatcctagtgatgttatacaacaatatactgaggtcataggt
cgtaccttcatgccaccatattggagtttaggatttcatctttgtagatggggtttccat
acagtaaatgaaacaatgcaggtggtaaagaacatgtctagatatggcatacctcaggat
gtacaatggaatgatatagattatatggatgctaaaaaagactttaccactgatctgaag
aattttggtgatcagtcagccatggtggatgaatttcataaactaggtttacattacatt
atgataattgatcctggaattagcagtaccacatcacctggtacctaccatccattagat
ttaggtttagaaatgggaatatttattaaagatattaatggtaaacctattgagggaaaa
gtgtggccaggtaacacatactttcctgattttactcatcctgattctcagaaatactgg
actaatatatctgctacattccataattcagttcaatttgatggcatctggattgatatg
aatgaaatcagtaattttgtggcaggatcaataaatggatgtcctactaattcttcttta
gaaaatccaccatatttaccagctataaatggtaataaattatcagttaatacactatgt
ttaacagctcaacaatatctatcttctcagtataatgttcataatctgtatggttttact
gaaacaagagctacacataatgctctggtaagcatacgccaaaagagaccttttgtaata
acacgttctacgtttgttggttctggttattatggtggacattggtcaggagataattat
gcttcttatcatgatctttatagatcaatttcagaatcattgagtatgaatatgtttggt
gtaacaatagtaggagctgatatttgtggttttagaggagatactacagaagaattatgt
acaagatggcatcagcttggtgctttttatacattctcccgaaatcataacaataatgga
aacaaggcccaagatccagcctcatttggtccagccctagccaagtcaactagaaaagtt
ttactaacaagatatacactattaccatatttatataccttgatacataaatcacacatg
atgggtcatactgttatgagaccactgttctttgagtaccccactgatgttacaacctac
aatatagacaaacagtttttatggggacccgctttattaataacaccagtattagatgag
ggagtaagaagtgttgaagggtattttcctaaagatatttggtatgatttttatactgga
caatgtattgtatctgaaggaggtggtcaaattttagatgccccactagataagattaat
cttcatgtacgtggtggatatatcttaccctggcaatatgctaatactaccacaacactc
agtcgtaaaaataagtttggattattggtggcattaaatagtagtggaggtgctgaaggt
gatctattttgggatgatggggatactttagatactcatgaaaagaaaatatttaatatg
tttactttcactgctgattcgaaaggagtatatgttaatgccatgtatataggactgtca
caagaatccatgtatttgggtgatatcactgtatttggtgttaaaactaaacccgccagt
ataacagttaataataaagctgtacaatttgtatataatgaccaatacaaggtattatat
atagctggacattcctttgatttatatcaacccattagattactctggacattttaa

DBGET integrated database retrieval system