KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_219759Help
Entry
LOTGIDRAFT_219759 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00052  Galactose metabolism
lgi00500  Starch and sucrose metabolism
lgi01100  Metabolic pathways
lgi04142  Lysosome
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    LOTGIDRAFT_219759
   00500 Starch and sucrose metabolism
    LOTGIDRAFT_219759
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    LOTGIDRAFT_219759
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lgi04147]
    LOTGIDRAFT_219759
Enzymes [BR:lgi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     LOTGIDRAFT_219759
Exosome [BR:lgi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LOTGIDRAFT_219759
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 20246890
NCBI-ProteinID: XP_009061461
JGI: 219759
UniProt: V3ZU33
LinkDB All DBs
Position
Unknown
AA seq 936 aa AA seqDB search
MAVSHAVFSAAFLGIGLLLSVVEGDGSCNVVASSRIDCYPGPGSSQGGCLAKGCCWVPAG
EGSSIPWCFKKSGDSSATLPPKISNPKCHNIDDSIKTDCFPELGASESSCQSRNCCWQPS
STQGTPWCFFPGNDNIGYKVDKIAKDGSMATLSQINDTHWPNDVKSLKLNVFKETSERLH
FKIVDAFNTRFEVPIKTPPTSNDGEANANYGVTIDQTSGGITVTRKSTGTKLFDSTVSPM
IYADQYIQITTSLPTTHIYGLGEHRGPILQDATSHIVKGFWARDQPPYEHVNLYGSHPLY
LGIEADGNAFGVYLLNANAMEIVINPGTPPTLTYRTIGGILDFYVFTGPTPNDVIRQYTD
VIGKPMLPPYWSLGYHNCRWGWGGSSGLREVIKRLRDNGVPFDTTWADIDYMDEHRDWTV
GNAFSELPDIVKDLHDHGQKFVPIVDPAISNKAGYIDYEEGIADDIFIKNQDDSVLIGKV
WPGDTAFPDFTHPKAYDWWYKSASRFHAKVPFDGIWIDMNEPANFVAGSNAGCSTSSLDK
PPFTPSIGGRNILEKTLCGSAKQHLGTHYNLHNMYGHFEGIATNKVLTKLLNKRPFVLSR
STFPSSGQYVAHWEGDNNADWHSLQLSIPEILNFNMFGIPFVGADICGFQGRTTDELCTR
WMQLGTFYPFMRNHRDIRGPHQDPMSPEFSSTTHANLKKTLLVRYHMLPFFYTAFYESHM
TGHGVVRPLFFKYPTDSNTLAIDDQFMWTDSLLVSPVTHQGKTTVEAYMPADRWFDLYSG
KETVGTGAKVVLQAPMDTINVHIRGGSIIPMQTPDVTTTKSRVNDFGLAVAPSSSNVASG
RLYWDDGDALDALSGSKYNLIDFKLAGNKLTFTVTKSGYVTKMTLGALSINGVASNPTKI
MLDGTRVPHAYDSVNKVVRLERLSVDLLKPHTITWS
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atggcagttagtcacgctgtgttttctgcagctttcctaggtattggattgctattatct
gtagtcgaaggagatgggtcatgtaatgtggtagcatcaagcagaatcgattgctatcca
ggacctggttcaagtcaagggggttgtttggcaaaaggttgctgttgggtgccagcagga
gaaggctcatctattccctggtgcttcaaaaaatctggagattcctccgctacactacca
ccaaaaatttccaatccaaaatgccacaatatagacgattcaatcaaaacagattgtttt
cctgaattaggcgcatccgagtcgagctgtcaaagtcgaaactgctgttggcaaccttca
agtacccaaggaacaccctggtgcttctttccaggaaatgacaatataggatacaaagta
gacaagatagcaaaagatggctcaatggcaacattgtcacaaataaatgacactcattgg
ccaaatgatgttaaatctttaaaactcaatgtctttaaagagacctcggagcgtctgcat
tttaagatagtagatgcatttaatacaagatttgaagtaccaattaaaacaccacctact
tctaatgacggagaagctaatgctaattatggagtcacaattgatcaaacttctggtgga
atcactgttacaaggaagtctacggggacaaaactattcgactctactgtctcaccaatg
atatatgcagatcaatatattcaaattacaacgtccttgcccacaacacatatctacggg
ttgggcgaacatcgtggaccaatattacaagatgctacctctcacattgtaaaagggttc
tgggcacgtgatcaaccgccatatgaacacgtcaatctttatggttcacatccgctgtat
ctgggaattgaggcagatggaaacgcttttggtgtttacctgctgaacgctaatgcaatg
gaaatagtaataaatccaggcactccaccaactcttacctacagaacaattggtggtatc
ttggacttctatgtatttactgggccaacacctaatgacgttattagacaatatactgat
gtcattgggaaaccaatgcttccaccttactggtcgttaggctaccataactgccgatgg
ggttggggaggtagttctggtttgagagaagtcattaagagattgagagacaatggcgtt
ccatttgataccacttgggcagatatcgactatatggatgaacacagagattggactgtc
ggaaatgctttctctgaattaccagatattgtgaaagacttgcatgatcatggtcagaag
tttgtaccaatcgtggatccagctatcagtaataaagcaggttatatagactatgaagag
ggtatagctgatgacatctttattaagaatcaggatgatagtgttttaattggcaaggtt
tggcctggtgatacagcttttccagattttacacatccaaaagcgtatgactggtggtac
aagtctgcaagtagatttcatgcgaaggttccctttgatggcatttggattgatatgaac
gaaccagcgaatttcgtggccgggtcaaatgctggttgttcaacgagcagcctagataaa
cctccttttactccttccatcggtggcagaaatatcttggaaaaaacattatgcggatcg
gccaaacagcaccttggcacgcattataatcttcacaatatgtacggccattttgaagga
attgcaactaacaaggtattgacaaagctgttgaacaaaaggccatttgtgctatcaaga
tcgacgtttccaagcagtggacagtatgtagctcactgggaaggtgataacaacgcagat
tggcacagtttacagttatctataccagaaatcttaaactttaatatgtttggaattcca
tttgtgggggccgatatttgcggtttccaaggacgaacaactgacgaactatgtacgaga
tggatgcagctcggaacattttaccctttcatgaggaaccatagagatatccgtggtcca
catcaagaccccatgtcacctgaatttagtagtacaactcatgcaaatttgaagaagaca
ctgctagtgagatatcatatgcttccatttttctacacagcattttatgaaagccatatg
accggacatggtgttgtcaggcccctattcttcaagtacccgacagattcaaatacacta
gctatagatgatcaatttatgtggactgatagtcttttggtatcccccgttacacatcag
ggtaaaacgactgttgaagcatacatgccagctgatcgatggtttgatttgtatagtggt
aaagaaacagttggtactggcgcaaaggtggtacttcaagcacctatggatacaattaat
gttcatattagaggtggttcaattattccaatgcagacacctgatgttactactacgaaa
agccgggttaatgattttggtttagctgttgctccatcttcttcaaatgttgcttcagga
cggctttattgggatgacggtgacgccttagatgccttatctggaagtaaatataacctt
atagatttcaaattagccggaaataaattaacatttactgtaacgaagtcaggatatgta
actaagatgactttaggagcattatctattaatggagtagcatccaacccaaccaaaatc
atgttagatggcacacgtgttccgcatgcttatgattctgtcaataaggttgtgaggcta
gaaagactatcagtggaccttctgaaaccccacactataacttggtcttga

DBGET integrated database retrieval system