KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_221335Help
Entry
LOTGIDRAFT_221335 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi00020  Citrate cycle (TCA cycle)
lgi00190  Oxidative phosphorylation
lgi01100  Metabolic pathways
lgi01200  Carbon metabolism
Module
lgi_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lgi_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lgi_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LOTGIDRAFT_221335
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LOTGIDRAFT_221335
Enzymes [BR:lgi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LOTGIDRAFT_221335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 20246988
NCBI-ProteinID: XP_009064001
JGI: 221335
UniProt: V3ZLV6
LinkDB All DBs
Position
Unknown
AA seq 669 aa AA seqDB search
MASLLKLSAQTAQKTAIKSLLTTGSKPLASSCSSRDFSFRVNGRNNSPNVSTGSQISRDY
PVIDHTYDAVVVGAGGAGLRAAFGLANEGFKTACITKLFPTRSHTVAAQGGINAALGHME
EDDWKYHFYDTVKGSDWLGDQDAIQYMCEEAPKAVIELENYGMPFSRLENGKIYQRAFGG
QSLKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLKYDTNYFIEYFALDLIMEDGECRGVI
ALCLEDGSIHRFKSKNTILATGGYGRAYFSCTSAHTCTGDGTAMVNRAGLANEDMEFIQF
HPTGIYGAGCLITEGSRGEGGYLINSEGERFMERYAPTAKDLASRDVVSRSSTIEIREGR
GCGPEKDHVLLQLHHLPPEVLHTRLPGISETAMIFAGVDVTRDPIPVLPTVHYNMGGTPT
NYKGQVIKYTREGGDEVVPGLYACGEAACASVHGANRLGANSLLDLVVFGRACANTIAAE
NKPGESIGNVKQNAGEESVSNLDKIRHANGSTPTADLRLNMQKTMQNYAAVFRDGVTLKE
GCDKMDGLFKQMDDLKVHDRGLIWNTDLVETLELQNLMINAIQTIYSAENRTESRGAHSR
EDFKHRIDEYDYSKPVEGQTPKPYDEHWRKHTLSYVDGDGKVKLDYRPVIDDTLDQNECP
MVPPAIRSY
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttgttgaagctgtctgctcaaactgctcaaaaaactgctataaaatctctt
ctaacaacaggaagtaagccattagcctcatcatgttcatctcgagattttagttttcgt
gttaatgggcgcaacaatagtcctaatgtctctactggttcgcagatctcaagagactat
cctgtcattgaccatacctatgatgctgttgtagtaggcgcaggaggagctggtctacgg
gcagcctttggtctggccaatgaaggtttcaagactgcctgtatcactaaactctttcct
actcgatcccacactgttgctgcccagggtggtattaatgctgcgctgggtcacatggaa
gaagatgattggaagtatcatttctacgacaccgtgaaaggttctgattggctgggagat
caagatgctatccaatacatgtgtgaagaggcaccaaaggccgtcattgagctggaaaac
tatggtatgccgtttagtcgtttggaaaatggtaaaatttatcagagggcatttggaggt
caaagtttaaagttcggcaagggaggtcaagctcatcgttgttgctgtgtggctgatagg
actggacattctttactacataccttatatggacgttcattgaaatacgacaccaactat
tttattgagtatttcgccctggatctcatcatggaagatggagaatgccgaggagttatt
gccctttgtttagaagatggctcaattcatagatttaaatcgaaaaataccatcttggcc
actgggggttatggtagagcgtatttctcgtgtacatcagctcatacgtgtacaggagat
ggtacagctatggtaaacagagctggtcttgccaacgaagacatggaatttatacagttc
catcctacaggtatttacggagctggctgtttgatcacagagggttcacgtggtgaggga
gggtacctcatcaactctgagggagagagatttatggagcgttatgcccccactgctaaa
gatttggcgtctcgggatgtggtatcacgatcttcaactattgagatcagagagggaaga
ggttgtggtccagagaaagatcacgtgctcctgcagttacatcatctaccaccagaggtc
cttcacacccgtttacccggaatcagtgagacagccatgatctttgctggagttgacgtc
acccgagatcccatcccagttttacccacagttcattacaatatgggtggtacacccaca
aactacaagggtcaggttatcaagtacaccagagaaggtggtgacgaagtagttccagga
ttgtacgcctgcggagaagcagcttgtgcctcagtccacggcgccaacagacttggtgcc
aactcgctactggatctggtagtatttggaagagcttgtgccaacactatcgctgctgaa
aacaaacctggagaatctattggcaatgtcaaacagaatgctggtgaagaatctgtatct
aatctagataaaatacgtcatgctaacggttctacacctacagctgatctacgtcttaac
atgcaaaagactatgcagaactatgctgctgtcttccgagatggggtgacactgaaggaa
ggatgtgacaagatggatggcttatttaaacaaatggatgacttgaaggttcacgataga
ggtttgatttggaacaccgatctagtagaaacattagagttacagaacttgatgatcaat
gctatccagactatttatagtgccgagaatagaacggaaagtaggggagctcactctaga
gaagatttcaagcaccgtattgatgaatatgactacagtaaaccagtagaaggtcagaca
cctaaaccctatgatgaacactggagaaaacatactctatcttatgttgatggtgacgga
aaggtgaagttggactacagaccagttattgatgatacgctagaccagaacgaatgtcca
atggtaccacctgcaattagatcttattaa

DBGET integrated database retrieval system