KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_228755Help
Entry
LOTGIDRAFT_228755 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K10776  DNA ligase 3 [EC:6.5.1.1]
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi03410  Base excision repair
Module
lgi_M00296  BER complex
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    LOTGIDRAFT_228755
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:lgi03400]
    LOTGIDRAFT_228755
Enzymes [BR:lgi01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     LOTGIDRAFT_228755
DNA repair and recombination proteins [BR:lgi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Short Patch-BER factors
     LOTGIDRAFT_228755
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N zf-PARP LIG3_BRCT DNA_ligase_A_C RNA_ligase zf-CCHH BRCT_2 mRNA_cap_enzyme DUF3802
Motif
Other DBs
NCBI-GeneID: 20247776
NCBI-ProteinID: XP_009057970
JGI: 228755
UniProt: V4BQT5
LinkDB All DBs
Position
Unknown
AA seq 903 aa AA seqDB search
MSDNRYIVGYAKLGTSSCKKCKTKIGKGDMRIGKVVSNPFSEDGGDMKQWFHPSCIFETF
VRARATTKKIEDPDDLEDFKDLKDEDKDVINQLIKDFLAKAGSKTSKTPVKKKAPVTQSK
LPFSPPKVETSTKETKPSTSKIDDDIEYDTNMSPEAEKDNSFREFRRLCALIAEENSYTG
KTAIVSKYIKKGSNGDKYQGSVYLLLKLLLPGVVKRVYNLNNKQLVKLFSQIFGCILADM
VEDLDKGDVAETIKTFFEQSKTLEPQRKSKLSIQQVDFLLEELSKVTKEDDQQRILTKMA
KRCTSNDLKMFIRLIKHDLRINSGAKHVLEALDPNAYEAFQASRNLEDVVERVLSNQKEA
SENGKPGMVKKLSVKAMLMTPVLPMLAEACRSVQQAMKKCPNGFYAEIKYDGERVQVHKK
GTEFRYFSRSLKPVVPHKVNHFKDYIPKAFPTGNDLILDAEVLLVDTKTGQPLPFGSLGV
HKKAAFQDASVCLFVFDCLHINGINLMEKPLKERRKVLQENMTEVKDHVKFSEYQHITKV
PNLQELMDKVFQEGLEGLVLKDVNGLYEPGKRHWLKVKKDYLHEGSMADSADLVVLGAYY
GTGNKGGLMSIFLLGVYDQMTKKWCTVTKIGNGLDDKTLDRLQTELDMVKISKDVTKVPG
WLNIKKTVVPDFVVADPKNAPVWEIIGAEFSKAEIHTADGISIRFPRVQKIRDDKNWETA
TDLSRLKKLYEKSKERTDIGGTEDEEDSNSSFISATSQTTPTVSPVKRKAESLTPSSSPL
KKMKPSCKYGENCYQTSPAHKKNFDHKAATPVKSSSNKLPDIFTGCKIYLPNNIDKYKVL
KRYVIAFNGDIVAEFDKNTATHLISTYGNSINASVKGKTVIDKWLWTCIKTKSLVPTTKY
LIT
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atgtcagacaatcgttatatagttggctatgctaaactgggaacatcaagctgtaaaaaa
tgtaaaacaaagattggaaagggagatatgagaattggtaaagttgtctccaatcctttt
agtgaagatggaggggatatgaaacagtggtttcatccatcatgtatttttgaaacattt
gtcagagcacgagcaactaccaagaaaattgaagatcctgatgatttagaagattttaaa
gatttaaaggatgaagataaagatgtgattaatcaactcatcaaagatttcttagctaaa
gctggttcgaaaacaagtaaaacaccagtgaaaaagaaagctccagtgactcaatccaaa
ttaccattttctccacctaaagttgaaaccagcactaaagaaaccaaaccatcaacaagt
aaaattgatgatgacatagaatatgataccaacatgtcaccagaggcagagaaagataac
tcattcagggagttccgtagattatgtgcacttatagctgaagagaattcttacactggt
aaaaccgctattgtatctaaatatattaaaaagggcagcaatggtgataagtatcaaggc
agtgtatatctattattaaaactcttattacctggtgttgttaaaagagtctataatcta
aataataaacagttggtgaagctcttcagtcaaatatttggatgtatattagctgatatg
gtagaagaccttgacaagggtgatgttgcagaaactattaagacattttttgaacagagt
aaaactctagaaccacagaggaaaagtaaactgtctatacaacaggttgattttctactt
gaagaattatcaaaagtcactaaagaagatgaccaacagagaattcttactaaaatggct
aaaagatgtacgtccaatgatttaaagatgtttataaggttgataaaacatgatttaaga
attaactcaggagccaaacacgtattagaggccttagatccaaatgcttacgaagcattt
caagcttcacgtaacttagaagatgttgttgaaagagttttatccaatcagaaagaagcg
agtgaaaatggtaaaccaggaatggtgaagaaactgagtgttaaagctatgttaatgaca
ccagtgttaccaatgttggctgaagcttgtcgttcagtacagcaagctatgaagaaatgt
cccaatggattttatgctgagattaagtatgatggtgagagggttcaagttcataaaaag
ggaactgaatttagatattttagtagaagtttaaaaccagtagttcctcacaaagtcaat
cattttaaagattatatcccaaaagcttttcccactggtaatgatttaatattggatgct
gaagttttattggtggatacaaaaactgggcagccattaccatttggttcacttggtgtt
cacaagaaagcagcattccaggatgcctctgtttgtttgtttgtatttgattgtttacat
attaatggtattaatctcatggaaaaacctcttaaagaaagaagaaaagttttacaagaa
aatatgacagaagtaaaagatcatgttaaattttcagaatatcaacacattacaaaagtg
cctaatctacaggaactgatggataaagtgtttcaggaaggattagaaggtctggtttta
aaagatgttaatggtttgtatgaaccaggtaaaagacattggttaaaagttaaaaaagac
tatctacacgagggcagtatggctgattcagcagatcttgttgtgttgggagcctactat
ggtacaggcaacaaaggtggtttgatgtccatatttttattgggtgtttacgatcagatg
accaaaaaatggtgtacagttaccaaaataggaaatggtcttgacgataaaacattagac
cgacttcagaccgaacttgatatggtgaaaatcagtaaagatgtcacaaaggtaccagga
tggctcaacatcaagaaaactgttgtccctgattttgttgtggctgatcccaaaaatgct
ccagtgtgggaaatcatcggagctgaatttagtaaagctgagatccatactgctgatggc
atctccatccgctttccaagagtacagaaaatccgcgatgacaagaattgggagactgct
acagatttatctagattaaagaaattgtatgaaaaatctaaagagcggacagatataggt
ggtactgaggatgaggaggactctaactcgagttttatatctgccacatctcaaactacc
cctacagtgtcacctgttaaacgtaaagctgaatccttaaccccttcatcttctccttta
aaaaagatgaagccatcatgtaaatatggagaaaactgctaccagacaagcccagctcac
aaaaaaaactttgaccacaaggcagccactcctgtcaaatcttcttccaataaattacca
gatatttttactggatgtaaaatctatctgcctaacaatatagataaatataaagtatta
aaacgttatgttattgcctttaatggagatattgtagctgaatttgacaaaaatacagcc
acacatttgatatcaacttatggaaattcaatcaatgcaagtgttaaaggaaaaacagtc
attgataaatggttatggacttgtattaaaaccaaatcattagttccaacaactaaatat
cttataacatga

DBGET integrated database retrieval system