KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_236404
Entry
LOTGIDRAFT_236404 CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
lgi  Lottia gigantea (owl limpet)
Pathway
lgi04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:lgi00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    LOTGIDRAFT_236404
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:lgi03000]
    LOTGIDRAFT_236404
Transcription factors [BR:lgi03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    LOTGIDRAFT_236404
SSDB
Motif
Pfam: bZIP_1 bZIP_2 Shugoshin_N ZapB YabA GIT_CC KASH_CCD Cep57_CLD_2 UPF0242
Other DBs
NCBI-GeneID: 20250139
NCBI-ProteinID: XP_009065480
JGI: 236404
UniProt: V3ZI82
LinkDB
Position
Unknown
AA seq 629 aa
MTLEYVSEVDRKFFDNNLLTKEDWGEPMTDGFGDISEFLDLNEELKSFTDDLPDDLMTFN
SPPLVDTILDDYWQEFNPKSSNEDLYNIQVKDEPLSPLSSNCSETGSEGYGSASDNSSCV
QPVITSPDIKIEDNVSITPFIVPSNTLPISSTSSPSVISTSSTSRVFTIIPKQEDSKQSI
ILNNVNGNSVGMLTPVNGTIKLNNIMQSKIKIQPKPCESTTSTAKRSPPVSNTKKPLVLT
PQEFTKLTSTGALCFQPPQSNSPVAMETGENTIPSFHTSMIDVTDVKNVKRQQRMIKNRE
SASLSRKRKKEYLSTLEDKINSCTSENQKLRQENDNLRKKVCVLQTENERLRLQSSYVNI
KKTTTCLLAIMIMLGFNIAPWSLLDGSKSVSNDVIPIHKGRQLMAVSDTDMKYESSKPWS
EPADFLMRELHRLTEEMTESSSNVTQQMCPTYFNKTESMLLAEQLAGWMIRHEEEKQKTQ
QKKRTGKKKVKSLRASLRGDVDAYKMEKRLEERAYQVQIFNGADENKDFLHAIHRRNDTF
YVLSFDQDYFLVPATAHNKTMRPRMSLVMPAMTLNETMKPPAGSIGMMQIDCEVVSTQLI
HVHNSVIPPHLKKNTTFNNQHRYKHSSRP
NT seq 1890 nt   +upstreamnt  +downstreamnt
atgactcttgaatacgtatccgaagttgacagaaaattttttgataacaatctcctcaca
aaagaagattggggtgaacctatgacagatggatttggtgatatatcagaatttctagat
ttaaatgaagaattaaaatccttcacagatgatctacctgatgatttaatgacatttaat
tcaccacctctagttgatacaatattagatgattattggcaggagtttaatcctaaaagt
tctaatgaagatttatataatattcaagtgaaagatgaacccctctcaccattatcatca
aattgttcagaaactggttcagaaggctatggttcggcatcagataacagttcctgtgtt
caacctgttatcacatctccagacatcaaaattgaggataatgtctcgattacaccattc
attgttccttcaaatacactccctatctcatctacatcttcaccatctgttatatcaaca
tcatcaaccagtagagtgttcacaatcattcctaaacaagaagatagcaaacaaagcatt
atattaaataatgttaatggtaactcagttggtatgttaacacctgtcaatggtaccatt
aaattaaacaacattatgcaatcgaaaataaaaattcaacccaaaccatgtgagtccaca
acttcaacagcaaaaagatctccgcctgtatcaaatacaaaaaaaccattagtgctaaca
ccacaagaatttaccaaattaacctcaactggtgcattatgttttcaaccaccacagtca
aacagtcctgttgctatggaaacaggagaaaataccattccatcctttcacacttctatg
attgatgtcactgatgtaaagaatgtcaaacgtcaacaaagaatgattaaaaatagagaa
tctgccagtttatcaaggaaaagaaagaaagagtatttatctacattggaagataaaata
aatagctgtacatcagaaaaccagaaattaagacaagaaaatgataatctcagaaagaaa
gtgtgtgttcttcagacagagaatgagaggttacgtttgcaaagtagttatgtgaatatt
aagaagacaacaacatgtctgttagctattatgattatgttaggttttaatattgctcct
tggagtttattagatggtagtaaatctgtctctaatgatgtcataccaatacataaaggg
agacaattgatggctgtgagtgatactgatatgaaatatgagtcatcaaaaccgtggtct
gaaccagctgatttcttgatgagagaattacatagattaacagaggagatgacagagagc
tctagtaatgtaacacaacagatgtgtccaacatattttaataaaacagaatccatgttg
ttggctgaacagttagcaggatggatgatcagacatgaagaagaaaaacaaaaaacacaa
cagaagaaaaggactggtaaaaagaaagtaaaaagtttaagggcatccttgagaggagat
gtagatgcatacaaaatggaaaaaagattagaagagagagcatatcaagtacagatattt
aatggagctgatgaaaataaagattttctgcatgctatacatcgtagaaatgatacattc
tatgttttatcatttgatcaggactattttctggtgcctgctacagcccataataaaaca
atgagacctagaatgtcattagttatgcctgccatgacactcaatgaaacaatgaagccc
ccagcaggtagtattggtatgatgcagattgattgtgaggtagttagtacacagctaata
catgtacataattcagttataccaccacatcttaaaaaaaatactactttcaataaccaa
catagatacaaacactcttctagaccttga

DBGET integrated database retrieval system