KEGG   Lottia gigantea (owl limpet): LOTGIDRAFT_81505
Entry
LOTGIDRAFT_81505  CDS       T03273                                 

Definition
(RefSeq) hypothetical protein
  KO
K09850  Ras association domain-containing protein 1
Organism
lgi  Lottia gigantea (owl limpet)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 Ras_bdg_2
Other DBs
NCBI-GeneID: 20252510
NCBI-ProteinID: XP_009066962
JGI: 81505
UniProt: V4B260
LinkDB
Position
Unknown
AA seq 296 aa
GQGHNFVPCQLFNPTWCDNCGDFIWGLSKQCVKCINCQYTCHHTCVPSVSLDCKTVSPTE
VPSTPDGSAAETSLSDKRAILVSPKPEIPAILEDKVTADIVNGVCKGDNQTDEGGETFQG
FLKVTLNFIRPITMSLGVRPPSIYEMLTKEHIVEQNTQSIAFYMPRDTVKSIHTSSKTTT
KEVIGDLLKKFHIIDHPRKFAMYEQEFDGHKIVKLRRVTDKEYPLHICLNWDTEYLKRYR
LVLQENETGEIVWDGFSLPELNNFLVVLSREENEYISQLQYKYKVMRRIITQRLKE
NT seq 888 nt   +upstreamnt  +downstreamnt
gggcaaggacataattttgtgccgtgtcagttgtttaaccccacttggtgtgataactgt
ggtgattttatttggggattgtccaaacagtgtgttaaatgtatcaactgtcaatataca
tgtcatcacacgtgtgtaccttcagtttcgttagattgcaagacagtttcgccaacagag
gtaccatcaacaccagatggcagtgccgcagagacttctctttcggataaacgggcaatt
ttagtgtcgcccaaacctgaaattccggctattttagaggataaagtgacagcagacatt
gtgaacggtgtttgtaagggagataatcaaacagacgaaggaggtgaaacattccagggc
tttctcaaggtcaccctcaatttcattcgaccaatcacaatgtctctaggagttcgacct
ccgtctatttatgaaatgttaaccaaggaacatatagtggaacagaacactcaatcaata
gccttctatatgcctagagacactgtcaaatccatccatacatcaagtaaaacaacaaca
aaagaagtgataggagatttattaaagaaattccatattatagatcatcctagaaagttt
gctatgtatgaacaggaattcgatggtcacaaaatagtaaaattacggagagtcacagat
aaagaatatcctctccatatttgtttaaactgggatacggaatatttaaaacgatataga
cttgttttacaggagaacgaaactggtgaaatagtgtgggatggtttcagtttaccagag
ttaaataatttccttgttgttttatctcgggaagaaaatgaatacatatctcaactacaa
tataaatataaagttatgagacgtattattacacagagattgaaagaa

DBGET integrated database retrieval system