KEGG   Lactobacillus gallinarum: AO203_02255Help
Entry
AO203_02255       CDS       T04115                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lgl  Lactobacillus gallinarum
Pathway
lgl00473  D-Alanine metabolism
lgl00550  Peptidoglycan biosynthesis
lgl01100  Metabolic pathways
lgl01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lgl00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AO203_02255
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AO203_02255
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AO203_02255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lgl01011]
    AO203_02255
Enzymes [BR:lgl01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AO203_02255
Peptidoglycan biosynthesis and degradation proteins [BR:lgl01011]
 Precursor biosynthesis
  Amino acid ligase
   AO203_02255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 GARS_A ATPgrasp_ST CPSase_L_D2 TTL
Motif
Other DBs
NCBI-ProteinID: ALJ22879
UniProt: A0A0N7I4R8
LinkDB All DBs
Position
complement(417537..418619)
Genome map
AA seq 360 aa AA seqDB search
MTKKTQVGLIFGGNSSEYEVSIVSGRNIYKAIDKEKFDVHPIWITNEGYFANEEESFKVL
EDPSYQVKNPHKVHNISNLIELENLPEIDVFFPIVHGNLGEDGVLQGLFRLMNKPFVGDD
VLAAAVTMDKEFTKILAQRVGVPVADWIAIKRFEYDDKNNDKLDYEKVAEKLGHDMFVKP
SNQGSSVGVSHVTNADEYAAALKEAFKYDDKVLVEETVPGTEVETAVLGNDKPIVAGVGQ
ITNAKGSFYSYKNKYDDNSTSKLQIPADLPQEIIDTVRRNARKVYEVTECSGMARIDSML
TPGGKVVLTEVNALPGFTNISMYPKLFEEAGVPYTELITRLIEVGMERFDHKKTLLHKHD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaaaaaacacaagttggattgatttttggtggtaactcatcagaatatgaagta
tcaattgtttcaggtcgtaatatttataaagcaattgataaagaaaaatttgatgtacac
ccaatttggattactaatgaaggctactttgcaaatgaagaagaaagtttcaaggtttta
gaagatccttcataccaagtaaagaacccacacaaggttcacaatatttctaatttaatt
gaattagaaaacttaccagaaattgatgtctttttccctattgttcacggtaacttgggt
gaagacggcgttttacaaggtttattccgtttgatgaataagccgttcgttggtgatgac
gtcttggctgctgccgtaaccatggacaaagaatttaccaagattttagctcaaagagtt
ggcgttcctgttgctgactggatcgcaattaaacgttttgaatacgatgacaaaaataat
gataaacttgattatgaaaaagttgctgaaaaacttggccatgacatgtttgttaagcca
tctaaccaaggttcatcagttggtgttagccatgtaactaacgctgatgaatatgcagca
gcattaaaagaagcatttaagtacgatgacaaggtattagttgaagaaactgttcctggt
actgaagtagaaactgccgtacttggtaacgacaagccaattgtagcaggtgtgggacaa
atcaccaatgcaaaaggctcattctacagctataagaacaaatacgatgacaattcaact
tctaagttacaaatccctgcagatttgccacaagaaattattgacaccgtaagaagaaat
gctcgtaaagtttatgaagttaccgaatgtagtggtatggctagaattgactctatgctt
actccaggtggtaaagtagtattgactgaagttaatgctcttccaggctttactaatatc
agtatgtatcctaagttgtttgaagaagcaggtgttccttacactgagttaattactcgt
ttgattgaagtaggaatggaacgttttgaccataagaagactttgcttcataagcacgat
taa

DBGET integrated database retrieval system