KEGG   Lactobacillus ginsenosidimutans: ABM34_03445Help
Entry
ABM34_03445       CDS       T03990                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lgn  Lactobacillus ginsenosidimutans
Brite
KEGG Orthology (KO) [BR:lgn00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lgn01001]
    ABM34_03445
Enzymes [BR:lgn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     ABM34_03445
Protein kinases [BR:lgn01001]
 Serine/threonine kinases: Other
  Bacterial family
   ABM34_03445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Pox_ser-thr_kin Kdo APH Pkinase_fungal DUF4519 KinB_sensor FeoB_associated
Motif
Other DBs
NCBI-ProteinID: AKP66709
UniProt: A0A0H4QEA3
LinkDB All DBs
Position
complement(668832..670790)
Genome map
AA seq 652 aa AA seqDB search
MDKGYLVGNRYEIIRTLGEGGMANVYLANDTKTNEKVAVKALRYDLQDDESVKRRFEREA
KATGTLSHPNIVNVLDVCNDNGNQYIIIEYVHGPNLKKYIRDNFPIPYHEVVSIMEQICS
AVAEAHAHGIIHRDLKPENILVDDSKHPIQVKVSDFGIALALSDRSITRTNSLLGSVHYM
SPEQIRGGSATELSDIYALGIILFELLAKTVPFKGDTAVAVAMKHSQEEIPDLQKIDPNI
PQSLENVVLKATAKDAKQRYQSVKDMYQDLKTVLLPERANEPKFVPNPMAGNDLDATRVM
TPIHPDKTQQRSKEPVKKNHKPRNIIIGSIIAAIALFFMIFMIVKGNQETTVPDLSNLTL
KQAKVMLKGSNLQVGNVSKENDDDVEAGHVIRSIPNKGLKLKNNADVNLVVSIGATYYKM
PNLVGKQYDDVQDNLDKRGFKVKLKYSANNNYTTGTILKQSIAVGDRVIAKKKTLTLTLA
KPQTAKKKVTRVRDLTGYNLKSIQDYAKEIDVTLDVSYAYSDSIDEGILISQNPSANSVI
NNGATLSVTMSKGSDPSDNSKDNDSNNNNSNSGTKTVTRNITIPYSNDGTGSPNKVTIYL
GDANHNISSPYRTMSISQDTPVTLSFNVKDGQTGNYTVESNNSTILSGSVSG
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atggataaaggttacctagttggaaatcgttatgagattattcgaactcttggtgaaggt
ggaatggccaatgtttatttggcgaatgacactaagacaaacgagaaggtagccgttaaa
gctttacgttatgatttacaagatgatgaatcagttaaaagaagatttgaacgtgaggca
aaggctactgggactctgtcacatcctaatatcgttaatgtcttggacgtttgtaatgat
aatggtaatcagtacattattattgagtacgttcatggacccaatttaaaaaaatatatt
cgtgacaattttccgattccatatcatgaagtcgtttcaatcatggaacaaatctgttct
gcggttgccgaggctcatgctcatggaattattcacagagatttaaaaccagaaaatatt
ttggttgatgattcaaagcatccaattcaagttaaagtatctgactttggtattgcactt
gccttaagtgatcgttctattactaggaccaattcgctgctgggttcagtacactatatg
tcgcccgagcaaattcgtgggggttcagcaactgaactttccgatatttatgcgttggga
attattttatttgaattgttagctaaaactgtaccgtttaagggtgataccgctgtagct
gttgcaatgaagcattctcaagaggagattccggatttacaaaaaatagatcccaatatt
cctcaatccttagaaaatgttgttttaaaagcaacagcaaaggatgcgaaacaacgttat
cagtccgtaaaggatatgtatcaagaccttaaaactgttctgcttccagaaagagccaat
gagcctaaatttgtacctaatccaatggctggcaacgatttggatgcaacacgtgtaatg
acaccaattcatccagataagactcaacaacgctctaaagagccggtgaagaagaatcat
aaaccccgcaacataatcattggatcgattattgccgccatagccctgttctttatgatt
tttatgatagttaaagggaatcaagagacaaccgttccagatctgagtaatttgacactc
aagcaagctaaagtaatgttaaagggttcaaatttacaagtaggaaatgtttctaaagaa
aatgatgatgatgttgaagcggggcatgttattagatctattccaaacaagggattaaag
ctaaaaaataatgctgatgtcaatttagttgttagtataggggcaacgtactataagatg
ccaaacttggttgggaaacaatatgatgatgttcaagacaatcttgataagcgtggattt
aaggtgaaacttaaatattcagcaaataataattacacaaccggaacaattttgaaacaa
agcattgctgttggtgatcgtgtcattgccaagaagaagaccttgacgttgacactggca
aaaccacaaacagcgaagaagaaagttactcgtgtaagagatttaactggttataacttg
aagagtatccaagattatgccaaagaaattgatgtgacacttgatgtttcatacgcttat
tctgattctattgatgaaggtattttgattagtcaaaacccttctgcaaatagtgtgatt
aataacggtgcaacactttcagtcacaatgtcaaaaggttcggatccttcggacaattcg
aaggacaatgattcaaataataataatagtaattcaggtaccaaaaccgtaacaagaaat
attacaattccatattcaaatgatggcactgggtctccgaataaagtaaccatttatctc
ggggatgcaaaccataatatttcgtcaccttacagaactatgagtatttctcaagacaca
ccagtaacattgagttttaacgtcaaagatggacagacagggaactacactgttgaaagc
aataattcaacaatcttaagtggttcagttagtgggtag

DBGET integrated database retrieval system