KEGG   Lactobacillus ginsenosidimutans: ABM34_08175Help
Entry
ABM34_08175       CDS       T03990                                 

Definition
(GenBank) transketolase
  KO
K00615  transketolase [EC:2.2.1.1]
Organism
lgn  Lactobacillus ginsenosidimutans
Pathway
lgn00030  Pentose phosphate pathway
lgn01100  Metabolic pathways
lgn01110  Biosynthesis of secondary metabolites
lgn01120  Microbial metabolism in diverse environments
lgn01130  Biosynthesis of antibiotics
lgn01200  Carbon metabolism
lgn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lgn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    ABM34_08175
  09109 Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    ABM34_08175
Enzymes [BR:lgn01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     ABM34_08175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh TPP_enzyme_C CbiJ
Motif
Other DBs
NCBI-ProteinID: AKP67507
UniProt: A0A0H4QHT1
LinkDB All DBs
Position
1591219..1593189
Genome map
AA seq 656 aa AA seqDB search
MDEDTRNIHALKMLAVEAISNANSGHPGIVLSVAPMLYTLATRHLVVDPETPDWINRDRL
VLSAGHGSALLYSHLHLSGFDLSMDDLKRFRQRGSRTPGHPEFGATPGVDATTGPIGQGV
GMAVGMAVAQKRLEAKFGNLMDHFTFAIVGDGDLMEGISHEAAEFAGINNLNKLVVLYDS
NDVSLDGPTSRSFKTNQRDRFAAYGFDTFLVEDGDDIDAIDEAITKAKASPNPAFIEIRT
IIGEGAPNQGTNKIHGAPLNDDALQVLEDNLDWHEAPFTVPDDVTTSFREKVFDRGHAAH
VAWGKELAESSQKAEILHDFEVPVSVDGTKLTTFKPGEKDAGRKVGHTAMNDIAKQVPNL
IGGAADLASSTKTEIEDGGTFSADNPTGKNIPFGVHEFGMSTIMNGIALHGGLKVFGSTF
AVFSDYLKAGIRLSALQKLPVIYIFTHDSIAVGQDGPTHQPIEQLSGLQSIPNLNVVRPG
SPNEIVSAWKMAIESTNRPTVMFLSRQDIQELPADNSATLLEKRGGYVANFEKGNLSAIL
LATGTELELAKAAQKELEKDNIFARVVSMPDQAKFLQQDILYRESVLPNNQRRRIAIEMA
SPLGWANVVGLDGKIIGTETFGESAKPDEVIEDFDFTVDNVVSSVKNLLFKMEKVG
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagatacgagaaatatacatgctttaaaaatgttagctgttgaagctatctca
aacgcaaattctggtcaccccggaatcgttctcagtgtggcacctatgctttacacatta
gccacaagacatttagtcgttgatcccgaaactccagattggattaatcgtgacagatta
gttctctcagctggacatggttcagcactgctatacagtcaccttcatctatcaggattc
gatttaagtatggatgatttgaaacgattcagacaacgtggttcacgtacaccaggacat
cccgaatttggtgcaacacctggtgttgatgcaactactggaccaattggacaaggcgtt
ggtatggccgttggtatggctgtcgctcaaaagagactagaggcaaaatttggtaacttg
atggatcacttcacattcgcaattgtcggtgatggtgatttaatggaaggaatttctcac
gaagctgctgaatttgctggtatcaataatctaaataaactagtcgtgttatacgattca
aacgatgtttcattggatggaccaactagtcgctcattcaaaactaatcaaagagatcgt
ttcgcagcatacggcttcgataccttcctagttgaagatggtgatgacatcgacgcaatc
gatgaagcaatcactaaagcaaaggcttcaccaaatccagcattcatcgaaatcagaact
atcattggtgaaggtgctcctaaccaaggaaccaacaaaattcacggcgccccactaaat
gacgatgctctacaagtattggaagacaatctagactggcatgaagctccattcacagtt
cctgacgacgtaacaacttccttccgggaaaaagttttcgaccggggccatgcagcacat
gtcgcttggggtaaagaattagctgaatcttcacaaaaggctgaaatcctccacgacttc
gaagttcctgtttcagttgatggaacaaaattaactactttcaaacctggcgaaaaagat
gctggtagaaaagttggtcacactgctatgaacgacatcgccaaacaagttccaaactta
attggtggagctgccgaccttgcttcctcaactaaaacagaaattgaagatggcggaact
ttctcagccgacaatccaactggtaaaaacatccccttcggtgttcacgaattcggaatg
agtacaatcatgaatggtatcgccctacacggtggtttgaaagtcttcggttcaactttc
gcagttttctcagattacttaaaagctggtattagattgagtgctttgcaaaaacttcct
gttatctacatcttcactcacgactcaatcgccgttggacaagatggaccaactcatcaa
cctatcgagcaactttctggacttcaaagcatccctaacctaaatgttgttagaccagga
agtcctaatgaaattgtttctgcttggaagatggctatcgaatcaactaatcgcccaacc
gtaatgttcttgagccgtcaagacattcaagaattgccagctgacaactcagctacattg
ctagaaaaacgtggtggctacgttgctaactttgaaaaaggtaacttgtcagcaatcctt
cttgctactggtaccgaactagaattagctaaagctgcacaaaaagaactagaaaaagac
aatatctttgctagagttgtatctatgccggatcaagctaagttcttgcaacaagatatt
ttataccgtgaaagtgttcttcctaacaaccaacgccgccgcatcgctatcgaaatggct
tcaccacttggctgggcaaatgttgttggccttgatggcaagatcattggaactgaaact
ttcggtgaatcagctaaacctgatgaagttatcgaagacttcgacttcacagttgataac
gtagtttcatcagttaagaatttactcttcaaaatggaaaaggtgggataa

DBGET integrated database retrieval system