KEGG   Lactobacillus ginsenosidimutans: ABM34_08220Help
Entry
ABM34_08220       CDS       T03990                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
lgn  Lactobacillus ginsenosidimutans
Pathway
lgn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lgn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    ABM34_08220
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgn02000]
    ABM34_08220
Enzymes [BR:lgn01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     ABM34_08220
Transporters [BR:lgn02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    ABM34_08220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_15 AAA_22 AAA_29 RsgA_GTPase G-alpha AAA_23 AAA_16 DASH_Spc34 AAA_33 AAA_30 AAA_18
Motif
Other DBs
NCBI-ProteinID: AKP67514
UniProt: A0A0H4QGI2
LinkDB All DBs
Position
complement(1600607..1601401)
Genome map
AA seq 264 aa AA seqDB search
MKTYNLEENSIAKVSDEIEISSENLQVYYGNSHAIFDANLQFAKNQVTSLIGASGSGKST
YLRCLNRMNDKLARVDGKIMYKDTDINAKKVNVYEVRKQIGMVFQMPNPFAKSIKENILF
GLQSNGIHDKNVLEERLESSLKEAALWDEVKDELSKSALALSGGQQQRLCIARSIAMRPE
ILLLDEPASALDPISTLKIEETVKALKKKYTIIIVTHSMAQATRISDYTAFFHLGHVVEY
DKTTKLFNDPSMPATSDYLSGDFG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacatacaatcttgaagaaaattccattgcgaaggttagcgatgaaattgaaatc
tcatcagaaaatctacaagtttactatggtaatagccatgccatctttgacgcaaatctt
cagtttgcaaaaaatcaagttacttcattgattggggcatctggatcaggtaaatctaca
tatcttagatgtctaaatcgtatgaatgacaaattggcccgtgttgatggaaaaattatg
tacaaagatactgacatcaatgctaaaaaagttaatgtgtacgaagtaagaaagcaaatt
ggaatggtatttcaaatgccaaatccatttgctaaatctattaaagaaaatatcttgttt
ggcttacaaagtaacggaatccacgataagaatgttttggaagaacgacttgaaagtagt
ttgaaagaagcagctttgtgggatgaagtaaaagatgaattaagtaagagtgctttggcc
ctttcgggtggacagcaacaacgtttatgtattgctcgttcaattgctatgcgaccagaa
attcttttacttgatgaaccggccagtgccttagatcctatttctacactgaagattgaa
gaaactgttaaggcacttaagaagaaatatacaattatcattgttactcacagtatggca
caagccactcgtatcagtgattacactgcgtttttccacttaggtcacgttgtagaatac
gataagacaacaaaattatttaacgatccatcaatgccagccacttctgattatttatct
ggtgattttggttag

DBGET integrated database retrieval system