KEGG   Lactobacillus ginsenosidimutans: ABM34_12205Help
Entry
ABM34_12205       CDS       T03990                                 

Definition
(GenBank) thioredoxin reductase
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
lgn  Lactobacillus ginsenosidimutans
Pathway
lgn00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:lgn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ABM34_12205
Enzymes [BR:lgn01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     ABM34_12205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA DAO FAD_binding_2 FAD_oxidored Thi4 HI0933_like NAD_binding_8 Lycopene_cycl FAD_binding_3 K_oxygenase NAD_binding_7 AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: AKP68221
UniProt: A0A0H4QM91
LinkDB All DBs
Position
2454739..2455680
Genome map
AA seq 313 aa AA seqDB search
MKEFDVVVIGAGPGGLTAALYASRANLSVMILDRGIYGGQMNNTAEIENYPGFDSILGPD
LSEKMYHSSTRFGAEFGYGAVESVEDNGNRKIVHTDDGDYEAKVVIVATGSQYKKIGVAG
ENELSGRGVSYCAVCDGAFFKDQDVAVIGGGDSAVEEGVYLTQMAKSVTIIHRRDQLRAQ
KVLQDRAFKNDKIKFVWNADVKEIVGEDDKVAGVRYVDKETGEEHVVPAKGAFIYVGIQP
MTEPFKSLGILDDAGWIDTDTHMKTNVAGVYAIGDVRKKDLRQVANAVGEGAIAGQEAFN
YIQTLSDAKVSAK
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaattcgacgtagtagtaataggtgcaggtcctggtggactaacagccgcattg
tacgcatcacgtgctaatttatcagtaatgattttagatcgtggtatttatggtggccaa
atgaataacaccgctgaaattgaaaattatcctggatttgattctattttaggaccagac
ctcagtgaaaaaatgtatcattcatcaacaagatttggtgcagaatttggttacggtgct
gttgaatcagttgaagataacggtaatcgtaagatcgttcacacagatgacggtgattac
gaagccaaagttgtaattgttgcaacaggttcacaatataagaaaatcggcgttgctggt
gaaaatgaattatcaggacgtggagtatcttactgtgccgtatgtgatggtgcattcttc
aaggatcaagatgtagccgtaatcggtggtggagattccgctgttgaagagggagtttac
ctaactcaaatggcaaaatccgtaacaattattcatcgtcgtgaccaattgcgtgcacaa
aaagtcttacaagaccgtgccttcaagaatgataaaattaaatttgtttggaacgccgac
gtaaaagaaatcgtcggtgaagacgataaagtagccggtgtccgctatgtagacaaagaa
actggtgaagaacacgtagtacctgcaaaaggtgcattcatttatgtaggtatccaacca
atgacagaaccattcaagagtttgggtattcttgacgatgctggctggattgatactgac
acacacatgaagacaaacgttgccggagtttatgctattggtgatgttcgcaagaaggat
ttgcgtcaagttgctaatgctgttggtgaaggtgcaatagctggtcaagaagcattcaat
tatattcaaacattgtcagacgctaaagtttctgcaaaataa

DBGET integrated database retrieval system