KEGG   Pseudoleptotrichia goodfellowii: JCM16774_0631
Entry
JCM16774_0631     CDS       T06508                                 

Definition
(GenBank) hexulose-6-phosphate isomerase
  KO
K03079  L-ribulose-5-phosphate 3-epimerase [EC:5.1.3.22]
Organism
lgo  Pseudoleptotrichia goodfellowii
Pathway
lgo00040  Pentose and glucuronate interconversions
lgo00053  Ascorbate and aldarate metabolism
lgo01100  Metabolic pathways
lgo01120  Microbial metabolism in diverse environments
Module
lgo_M00550  Ascorbate degradation, ascorbate => D-xylulose-5P
Brite
KEGG Orthology (KO) [BR:lgo00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    JCM16774_0631
   00053 Ascorbate and aldarate metabolism
    JCM16774_0631
Enzymes [BR:lgo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.22  L-ribulose-5-phosphate 3-epimerase
     JCM16774_0631
SSDB
Motif
Pfam: AP_endonuc_2 DUF3798 Glyco_hydro_97 DUF4862
Other DBs
NCBI-ProteinID: BBM35702
UniProt: A0A510J8R4
LinkDB
Position
605176..606051
AA seq 291 aa
MKDLNKLNLGIYEKALPKDIDWIERIKLVKECGYDFVEMSVDETDERLARLDWSDEEINK
IHEALVNTGVRIPSMCFSGHRRFPMGSMDEKTREKAMELMQKAIIFADKLGIRTIQMAGY
DVYYEEGSEQTKKYFTENLKKAIEWASSYNITLAIEIMDHPFINSITKYMEYSEIIKSPW
LKVYPDVGNLTAWPENDTLKELELGIKQGEIVAIHLKDTLAVTDTFPGKFKEVPFGEGCV
DFPKVFAKLKELNYKGPFLIEMWTEKSDNPIEEVKKAKEWMLDKMKKGGFI
NT seq 876 nt   +upstreamnt  +downstreamnt
atgaaagatttgaataaactgaatttaggaatatatgaaaaagctcttcctaaagatatt
gactggatagagagaataaagcttgtaaaagaatgtggatatgattttgttgaaatgtct
gttgatgaaactgacgaaaggcttgcaagacttgattggtctgatgaggaaattaataaa
atacatgaagctcttgtaaatacaggtgtaagaattccttcaatgtgttttagcggacat
agaagatttccgatgggaagcatggatgaaaaaacaagagaaaaagctatggaacttatg
caaaaagctataatttttgcggataaactgggtatcagaacgattcaaatggcaggatat
gatgtttattatgaagaaggaagtgaacagactaaaaaatattttacggaaaatctgaaa
aaggctatagaatgggcttcttcgtataacataacattggctatagaaataatggatcat
ccttttataaactcaattacaaaatatatggaatattcggagataataaaatctccgtgg
cttaaagtttatcctgatgtgggaaatctaactgcatggcctgaaaatgatacattgaaa
gaattggaactcggtataaaacagggagaaatagtagcaattcatttaaaagatacttta
gctgtaacggatactttcccgggtaaattcaaagaagtgcctttcggagaaggatgtgtt
gattttcctaaagtatttgccaaattaaaagagttaaactataaaggaccttttttgata
gaaatgtggactgaaaaatccgataatccgattgaagaagtaaaaaaagctaaagaatgg
atgcttgataaaatgaaaaaaggaggctttatctaa

DBGET integrated database retrieval system