KEGG   Leptotrichia goodfellowii: JCM16774_1377Help
Entry
JCM16774_1377     CDS       T06508                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lgo  Leptotrichia goodfellowii
Brite
KEGG Orthology (KO) [BR:lgo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JCM16774_1377
Enzymes [BR:lgo01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     JCM16774_1377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA HI0933_like FAD_binding_2 DAO Thi4 K_oxygenase FAD_oxidored NAD_binding_9 AlaDh_PNT_C ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: BBM36445
UniProt: A0A510JDX9
LinkDB All DBs
Position
complement(1351606..1352586)
Genome map
AA seq 326 aa AA seqDB search
MDFNLNLGALEEGKLKKIDENELYDVIVVGTGPAAMSASIYAVRKGLSVAQIGLKVGGQI
LDTNEIENIIGTPKTTGSEFAAAMEKHMKEYEIAFKEGHLVKEIKEDGKDKVLVTDDGKS
YKTKTVIIATGAEWKQLNIPGENEYVGKGVHYCSTCDGPFYKNLDVAVIGGGNSGVEAAL
DLAGIAKHVTLLEFMPELKADMVLQNKLSERDNIKVITNAQTTSVEGTQFAEHLKYLDRA
TNTEKDLKIDGVFIEIGLSPKSGLVKGLAELNKMGEIIIDEYNMTSNKGIFAAGDVTAVK
QKQIVVAIGEGAKAALGAFEYIIKKY
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggactttaatttgaacttgggagcattggaagaaggaaaattaaaaaaaatagatgaa
aatgaattatatgatgtaattgtagttggaacaggacctgcagcgatgtcggcttctatt
tatgctgtaagaaaaggactttctgtagcacagataggactgaaagtaggaggacagata
ttagatacaaacgaaattgagaatataataggaactccgaaaactacaggttccgaattt
gcagcggcaatggaaaaacacatgaaagaatacgaaatagcctttaaagaaggacatctt
gtaaaagaaataaaagaagacggaaaagataaagtattggtaactgatgacggaaaaagt
tacaaaacaaaaactgtaataatagctacaggtgcagaatggaaacagttgaatattccg
ggagaaaatgaatacgtcggaaaaggagtacactactgttctacatgcgacggacctttc
tataaaaatcttgatgtagcagttatcggaggaggaaattcgggagtggaagctgctctt
gatttagcagggatagcaaaacatgttacattattggagtttatgcccgaattgaaagcg
gatatggttttgcaaaacaaattatccgaaagagacaacataaaagttattacaaatgct
caaactacatcagttgaaggaactcaatttgcagaacacttgaaatatctcgacagagca
actaatactgaaaaagatttgaaaatagacggcgttttcatagaaataggattgtcgcca
aaaagcggattggttaaaggtttggcagaattaaataaaatgggagaaattataatagac
gaatataatatgacaagcaataaagggatttttgctgcgggagatgttactgccgttaag
cagaaacaaatagttgtggcaataggagaaggagcgaaagcggcacttggagcttttgaa
tatataattaagaaatattag

DBGET integrated database retrieval system