KEGG   Lactococcus garvieae ATCC 49156: LCGT_0213Help
Entry
LCGT_0213         CDS       T01618                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
lgr00473  D-Alanine metabolism
lgr00550  Peptidoglycan biosynthesis
lgr01100  Metabolic pathways
lgr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lgr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LCGT_0213
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LCGT_0213
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LCGT_0213
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lgr01011]
    LCGT_0213
Enzymes [BR:lgr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LCGT_0213
Peptidoglycan biosynthesis and degradation proteins [BR:lgr01011]
 Precursor biosynthesis
  Amino acid ligase
   LCGT_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: BAK57726
LinkDB All DBs
Position
212677..213726
Genome map
AA seq 349 aa AA seqDB search
MSKETLILLYGGRSAEREVSVLSAESVMRAVNYDKFRVKTYFISQAGDFIKTQEFTETPA
ENEKLMTNQTVNSEQKVAPSDIYEKDAVVFPVLHGPMGEDGSIQGFLEIMRLAYVGPNIL
SASSTMDKLLAKHVFTAVGVPQVPYVAAYADENQEKIHAEVQDKLTFPVFVKPANMGSSV
GISKVSSLEELEAGLAEAYKYDNRVVIEQGVNAREIECAVLGNGGKVRSTLPGEVVKDVD
FYDYRSKYIDNKIEMAIPADIPAEVAEKMRHYAEKAYQAMNGAGLSRCDFFYDQKGDIYL
NEINAIPGFTQWSMYPLLWENMGLSYSELIEELVSLAQEAFEIRESHLL
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaacattgattttattatatggcggtcgaagtgcagaacgagaagtttcc
gttctttcagctgaaagcgtaatgcgcgcagtgaactatgacaagtttagagtgaagact
tacttcatcagtcaagctggtgattttatcaaaacacaagaattcactgaaacacccgca
gaaaatgaaaaattaatgaccaatcaaacggtcaattcagaacaaaaagttgccccatcg
gacatttatgaaaaagatgcagttgttttccctgttttacatggccctatgggtgaagat
ggctcaattcaaggcttcttagaaattatgcgcctggcttatgttggtccaaatatttta
tcggccagcagtacgatggataaacttttagcgaagcatgtgtttaccgctgtaggtgta
ccgcaagttccttatgttgcggcatatgccgatgaaaatcaagaaaaaattcatgcagaa
gttcaagataaactgacttttcctgtttttgtcaagccagccaatatgggttcaagtgtc
ggcatttctaaagtaagcagcttagaagagttagaagcagggcttgcagaagcttacaaa
tatgataaccgtgtggtgattgaacaaggggttaatgcgcgcgaaatcgaatgtgccgtt
ttaggaaatggtggcaaagtacgctcaacactacctggtgaagtcgttaaagatgttgat
ttttatgactaccgttcaaaatacatcgataataaaatcgaaatggcaattcctgcggat
attccagcagaagtcgcagagaaaatgcgtcattatgctgaaaaggcttatcaagctatg
aatggtgcagggctctcccgttgtgactttttctatgatcaaaaaggagatatctatctc
aacgagattaatgcaattccaggatttacacaatggtcaatgtaccccttgctctgggaa
aatatgggactttcctacagtgagttgattgaagaacttgtctctctggctcaagaagcc
ttcgaaattcgagaaagtcacctcttataa

DBGET integrated database retrieval system