KEGG   Lactococcus garvieae ATCC 49156: LCGT_1579Help
Entry
LCGT_1579         CDS       T01618                                 

Definition
(GenBank) enoyl-[acyl-carrier protein] reductase
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
lgr  Lactococcus garvieae ATCC 49156
Pathway
lgr00061  Fatty acid biosynthesis
lgr00780  Biotin metabolism
lgr01100  Metabolic pathways
lgr01130  Biosynthesis of antibiotics
lgr01212  Fatty acid metabolism
Module
lgr_M00083  Fatty acid biosynthesis, elongation
Brite
KEGG Orthology (KO) [BR:lgr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    LCGT_1579
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LCGT_1579
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    LCGT_1579
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:lgr01004]
    LCGT_1579
Enzymes [BR:lgr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     LCGT_1579
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     LCGT_1579
Lipid biosynthesis proteins [BR:lgr01004]
 Fatty acid synthase
  Component type
   LCGT_1579
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short Enoyl_reductase KR AdoHcyase_NAD
Motif
Other DBs
NCBI-ProteinID: BAK59092
LinkDB All DBs
Position
complement(1548551..1549303)
Genome map
AA seq 250 aa AA seqDB search
MFLEGKKIVIMGVANNKSIAWGCAKAMKDQGATLIYTYQNERMEKQLAKLAGPEDLLIEC
DVVSDESIRRAFSTIESRVGKIDGLVHAIAYSKKEELDGNVSDISRDGYALAQDISAYSL
LAVAKAAKPLFNEGSGIVTLSYMGSVRAIPNYNVMGIAKAALEASVRYLAAEMAHVGVHV
NAISAGAIKTLAVSGVAGYKDLIKESNSRTADGKGVTIEEIGQTAAFLVSPLATGVIGDV
VYVDKGVHLT
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtttttagaaggaaaaaaaatcgtcattatgggtgttgctaacaacaagtctatcgct
tggggttgcgctaaagctatgaaagatcaaggggcgaccttgatctacacttatcaaaat
gaacgtatggaaaaacagcttgcaaagcttgctggaccagaagatctacttatcgaatgt
gatgttgtatcagacgaatctatccgtcgcgcattttcaactattgaaagccgcgtgggc
aaaatagacggtttggtacatgccattgcttattcaaaaaaagaagaacttgatggtaat
gtatcggatatctcacgtgacggctatgcacttgcacaagatatctcagcttactcattg
cttgctgtagcaaaagctgcaaaacctttatttaatgaaggttctggtattgttactttg
agctatatgggctctgttcgtgcaattcctaactacaatgtaatgggtattgctaaagca
gctctagaagcaagtgtacgttacttggcagcagaaatggcacacgttggtgttcatgtc
aatgctatttcagcgggtgccatcaaaacacttgcagtatccggtgttgcaggctacaaa
gatttgattaaagaatctaacagccgtacagctgacggtaagggtgtaacgattgaagaa
attggacaaaccgctgccttcctcgttagtcctttggctacaggtgtcattggagatgtg
gtttatgtggataagggtgttcacttaacataa

DBGET integrated database retrieval system