KEGG   Lactococcus garvieae ATCC 49156: LCGT_1626Help
Entry
LCGT_1626         CDS       T01618                                 

Definition
(GenBank) kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lgr  Lactococcus garvieae ATCC 49156
Brite
KEGG Orthology (KO) [BR:lgr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lgr01001]
    LCGT_1626
Enzymes [BR:lgr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     LCGT_1626
Protein kinases [BR:lgr01001]
 Serine/threonine kinases: Other
  Bacterial family
   LCGT_1626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA Kinase-like RIO1 Kdo APH DUF5345 Haspin_kinase FTA2 ETRAMP
Motif
Other DBs
NCBI-ProteinID: BAK59139
LinkDB All DBs
Position
complement(1604468..1606426)
Genome map
AA seq 652 aa AA seqDB search
MIQIGKIFADRYKIIKEVGRGGMANVYQGEDTYLDNRQVAIKVLRSNFENDNIAIARFQR
EAFAMAELSHPNIVSISDVGESENQQYIVMEYVDGMTLKQYINEHAPLSNDEAVNITSEI
LSAMECAHNHGIIHRDLKPQNVLLSQSGNVKVTDFGIAKALTETSLTQTNTMFGSVHYLS
PEQARGANATLQSDIYAIGIILFELLTGQIPFDGDSAVAIALKHFQENVPSIININKNVP
QALENVVIKATAKDINNRYANVEEMMTDLATATSLDRKGEPKLTFDKDLDATKALPSKLI
NPYDTKPLIDHSQSEQKDEAKDKATEDKAQADSEQKKKKSRKRLIAWIILALVLIAGDVT
AWMITTPQNVSVPDVTNMTQAEAESKLKEKNLAVGNIIPELSTTVEKDKVTRTNPESGSN
VRKNSKVDIYVSQGATGFKMDDYVGQKYEDVVDELVLNKNISKSQIKVNYVSSSEDSGTI
VKQTPAKGEFFDPTGNDQITFDVSEGETVIMPALALTSGGLSSTSAISYLNQLESLGVPT
SNITFVDASTASKVSSSNLDGYYVTQTSPESGKEFNPSNTKITLTVAKASNGNTGGNQTP
ETTTETTPETTPATTPETTPATSPEQGKDSSNQEKDSSSNNGNTNSTTEQSS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaatcggaaaaatctttgcagatcgctataaaatcattaaagaagttggccgt
gggggtatggccaatgtttatcaaggtgaggatacttatcttgataatcgtcaagtcgct
attaaagttttgcgttctaattttgaaaatgacaatattgccattgctcgttttcaaaga
gaagcattcgcaatggcagaactttctcaccctaatatcgtgagtatttctgatgtagga
gagtctgaaaatcaacaatatatcgttatggaatatgttgatggcatgactttaaaacaa
tacatcaatgaacatgcccctttgtcaaatgacgaagcagtgaacattacttcagaaata
ctttcggctatggaatgtgcacacaaccacggcattattcaccgggatttgaaaccgcaa
aacgtgctactctcgcaaagtggtaacgtgaaagtcacggacttcggcattgccaaggct
ttgacagaaacgagtttaacacaaaccaacacgatgtttggtagtgtgcactacttatcg
ccagaacaagcgcgtggtgcaaatgcaacacttcagtccgatatttatgccattggtatt
atcttatttgagttgttgacaggacagatcccgtttgatggggattctgcagtagccatt
gccttgaaacatttccaagaaaatgttccaagcattatcaacatcaataaaaatgtccct
caagcattggaaaatgtcgtcatcaaagcaacagctaaagatatcaacaatcgctatgca
aatgttgaagagatgatgacggatcttgctacagctaccagtttagatcgtaaaggagag
ccgaagcttacctttgataaggatttagatgccactaaagctttgcctagtaagttaatc
aatccttatgatacaaaaccgctcattgatcattctcaatctgagcaaaaggatgaagcg
aaagataaagctactgaagataaggcacaagcagattctgagcagaaaaagaaaaaatca
cgtaaacgcttgattgcttggattattcttgcccttgtgcttatcgcaggagatgttaca
gcttggatgattacaacgcctcaaaatgtttcggttcctgatgtgacaaatatgacacag
gcagaagcagaaagtaaactgaaagagaaaaatcttgctgtaggaaatattattccagaa
ttaagtacaacagttgaaaaagataaagtaacacgtacaaatcctgaatctggttcaaat
gttcgaaaaaatagcaaagtagatatctatgtttcacaaggtgcaactggcttcaagatg
gacgactatgtgggtcaaaaatatgaagacgttgtggacgagcttgttttgaataaaaat
atcagtaagagccaaattaaggtaaactacgtgtcaagctctgaagattctggcactatt
gtgaaacaaacgccagctaaaggagagtttttcgatccgacaggtaacgatcaaatcaca
tttgatgtatctgaaggggagacagtaattatgcctgcacttgcccttacttcaggtgga
ttaagctcaacatcagcaatcagttacctcaatcagctggaaagtcttggcgtaccgaca
tcaaatataacatttgttgatgctagcacggcgagcaaggtttcaagttctaacctcgat
ggttactacgtaacgcaaaccagtcctgaatcaggaaaagaatttaatccttcaaataca
aaaattactttgacagtggctaaagctagcaatggtaataccggtggcaatcaaacgcca
gaaacaacaactgaaaccactccggaaacaacaccagcgacgactccagaaacaacacca
gcgacttcaccagaacaaggtaaggactcttcaaaccaagaaaaagattcttcttccaac
aatggaaatacgaatagtacaacggagcagtcgtcttaa

DBGET integrated database retrieval system