KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_0344Help
Entry
LEGAS_0344        CDS       T01267                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00473  D-Alanine metabolism
lgs00550  Peptidoglycan biosynthesis
lgs01100  Metabolic pathways
lgs01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lgs00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LEGAS_0344 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LEGAS_0344 (ddl)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    LEGAS_0344 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lgs01011]
    LEGAS_0344 (ddl)
Enzymes [BR:lgs01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LEGAS_0344 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:lgs01011]
 Precursor biosynthesis
  Amino acid ligase
   LEGAS_0344 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp HUN
Motif
Other DBs
NCBI-ProteinID: CBL90992
LinkDB All DBs
Position
351001..352134
Genome map
AA seq 377 aa AA seqDB search
MTKKHVALLFGGNSSEHDVSKRSAQNFYDAIKATGKYEITVFAIAQNGYFLDPESSNRVL
ALEDEQPIVDAYMAKIDTTDPLARISALSEGGDFDIFFPVVHGNLGEDGTLQGLFKLLNK
PYVGAPLRGHAVSFDKAMTKELLTVNGIRNTKYVVLDPKTAKEWTWEKVVAALGDIVFVK
AANQGSSVGISRAKNAVEFEAALSDSFQYDYKVLVEQAVKGSRELEVGVIGNEEPIVSEI
GAHTLPNQGSGDAWYDYNNKFVDNSDVLFEIPAKLPESVTNEVKDMAIQAYKVLNLRGEA
RMDFLLDENNVPYLGEPNTLPGFTNMSLFKRLWDYSDIDNVKLVDMLITYGFAEFEKNAQ
LSYQFVTLGEEKIGKFN
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaacatgttgctttattatttggtggtaattcatcagaacacgatgtatca
aaacgttcggctcaaaatttttatgatgcaattaaagcaaccgggaaatacgaaataacg
gtttttgcaattgcacaaaatggctactttttagatccagaaagttcaaaccgtgtgcta
gcattagaagatgaacaaccaattgttgatgcctacatggcaaaaattgatacgactgat
ccattggctcgcattagtgcattaagcgaaggtggcgatttcgatatatttttcccagtt
gtacatggtaatttgggtgaggatggtacactacaaggattgtttaaattattgaacaaa
ccttatgttggtgcaccattacgcggtcatgcagtgagttttgataaggcgatgaccaaa
gagttattgacagtcaatggtattcgtaatacaaaatatgtagttctcgatcctaagact
gctaaagaatggacgtgggaaaaagttgtcgcagcactcggtgatattgtttttgtcaaa
gcagctaaccaaggttcctctgttggtatttctcgtgctaaaaatgcagttgaatttgaa
gcagctctgtcagattcatttcaatatgactataaagttttagttgaacaagctgtcaaa
ggatcacgagaactggaagttggtgtgattggtaacgaagagccaattgtatcggaaatt
ggggcgcatacattaccaaatcaaggttctggtgatgcatggtatgattacaataataag
tttgtcgataattcagatgtgctttttgaaattcctgcgaagttaccagaatctgtaaca
aatgaagtaaaagatatggctatacaagcttataaagttctgaatttacgaggtgaggca
aggatggatttcttgttagatgagaacaatgtaccatatctaggggaaccaaatacattg
cctggttttacaaatatgtcgttgtttaaacgactgtgggattattcagatattgataat
gtaaagcttgtagatatgttaataacatatggttttgcagaatttgaaaaaaatgcgcaa
ttaagttatcaatttgttactttgggtgaagaaaagatagggaagtttaattaa

DBGET integrated database retrieval system