KEGG   Leuconostoc gelidum subsp. gasicomitatum: LEGAS_0393Help
Entry
LEGAS_0393        CDS       T01267                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
lgs  Leuconostoc gelidum subsp. gasicomitatum
Pathway
lgs00240  Pyrimidine metabolism
lgs01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgs00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    LEGAS_0393 (tdk)
Enzymes [BR:lgs01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     LEGAS_0393 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK zf-C4_ClpX AAA_22 AAA_30 DUF2075
Motif
Other DBs
NCBI-ProteinID: CBL91041
LinkDB All DBs
Position
394895..395515
Genome map
AA seq 206 aa AA seqDB search
MAQLFFEYGAMSSGKSIEILKVAHNYESQGRQVLLMTPITDTRAGIGVVASRIGLSREAL
AVKPADDLYVLIKSMAANDLAVVLVDEAQFLTPEQVDQLAYTVDNLHIPVMAFGLKQDAF
NNLFAGSKRLIELADKLEEMKTICSFCGKKATTQLRIVNGKPQRQGAQVFIGGDEAYIPT
CRRHWFNPDLDKIATMFPYEATEHAK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactattctttgaatacggcgcaatgagttcaggtaaatcgattgaaatttta
aaagtagcgcacaattacgaatcacaaggtcgacaggtacttttgatgacgccaattact
gatacacgtgcaggtattggggttgtcgcaagtcgtatcgggttatcccgtgaggcttta
gcagtcaaaccagcagacgatttatatgttttgattaaaagtatggcagctaatgatttg
gccgttgttttagtggatgaggcacagtttttaacaccagaacaggtagatcaactagcc
tatacagtagataacttacatattccagtgatggcgtttggcttaaaacaagatgctttc
aacaatttatttgctggatcaaaacgattgatcgaattagcggataaactagaagaaatg
aaaaccatttgttcattttgtggcaaaaaagcaacaacccaactgagaatagtcaatggt
aaaccgcaacggcaaggcgcacaagtattcattgggggtgacgaagcttacattccaacg
tgccgccgtcattggttcaatcctgatctagacaaaattgcgacaatgtttccatatgaa
gcaactgaacatgccaaataa

DBGET integrated database retrieval system