KEGG   Legionella geestiana: E4T54_09270
Entry
E4T54_09270       CDS       T06170                                 

Definition
(GenBank) TIGR03749 family integrating conjugative element protein
Organism
lgt  Legionella geestiana
SSDB
Motif
Pfam: DUF3438 TraK
Other DBs
NCBI-ProteinID: QBS12917
UniProt: A0A0W0U9F6
LinkDB
Position
2067860..2068639
AA seq 259 aa
MKTFKYWFALLALFSSCELFALDAEHVLWDKTPIHLSLSLNEERLVHFPQAISIVDNEAG
DKITVLKVQDALYLKGKQAFENKRLLVQLMPQGEVIILTLSANDKITASKPIEVLLESKE
EAGAPQSANAFDINAITLTRFAIQSLYAPQRLLVIPDGVSRTPMQTRRLISLVYGASMEA
RPLISWHGGAFYVTAVELKNLLNKDVIVDPRRMSGNWQTATFYPTNTLAPRGKEDTTTVF
LVSDRPFHEALVRAREYVR
NT seq 780 nt   +upstreamnt  +downstreamnt
atgaaaacgtttaaatactggttcgctttactggccttattcagcagctgcgagctgttc
gcactcgatgccgaacatgttctgtgggataaaacaccgatacatttaagcttgtcattg
aatgaagagcggctggtgcattttccccaagccatcagcattgtcgataatgaagccggc
gacaaaatcactgtgttaaaagtacaggatgcgttatatctgaaagggaaacaagccttt
gaaaacaaacgtctgctggttcagcttatgccccagggtgaggtcattattctcaccttg
tcagccaatgacaaaattacggcaagcaagccaattgaagttttacttgaaagcaaagag
gaagccggtgcgccgcaaagtgccaatgcctttgatatcaacgctatcacactgacccgt
tttgccattcaatccttatatgcaccccaacgcctgctggtcattccggacggtgttagc
cgaacccccatgcaaacaagacgtctgataagcctcgtttatggtgccagcatggaagca
cgaccactgatttcctggcatggtggtgcgttttatgtaacggctgtggagctgaaaaac
ctgctcaacaaggacgtgatcgttgatccgcgacgcatgagcggcaactggcaaaccgcg
acattttaccccaccaacacgcttgcaccccgcggcaaggaagatacaacaaccgtattt
ttagtatcggacagaccttttcatgaagcactggtcagagctcgggagtacgtacgatga

DBGET integrated database retrieval system