KEGG   Lysobacter gummosus: LG3211_0323Help
Entry
LG3211_0323       CDS       T04163                                 

Gene name
sod1
Definition
(GenBank) superoxide dismutase [Cu-Zn] domain protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
lgu  Lysobacter gummosus
Brite
Enzymes [BR:lgu01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     LG3211_0323 (sod1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu DUF4223
Motif
Other DBs
NCBI-ProteinID: ALN89313
UniProt: A0A0S2G0N2
LinkDB All DBs
Position
365656..366231
Genome map
AA seq 191 aa AA seqDB search
MKTLLRTATIAAAIAALAACGGQTTKPTPPPAAGPKPVSTAQSATVVLASASGSLVSGKL
SLRPMGDGVHLTGEIGGLAPNSTHAIHIHEKGDCSAADASSAGGHFNPAGQPHGQVDRGP
HHAGDMDNLVANAEGVAQVNAHASGVTLGGGAPNDIAGRGVIVHASADDYKTQPTGNAGG
RLACGVIKIGR
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgttgcttcgcaccgccacgatcgccgccgccatcgccgcgctcgccgcttgc
ggcggacagaccaccaagcccacgccgccgccggcggccggacccaagccggtctcgacc
gcgcaatcggcgacggtggtgctcgcgtccgcgtccggcagtctggtcagcggcaaactg
agcttgcgtccgatgggcgacggcgttcatctgaccggcgaaatcggcggcctcgcgccc
aacagcacccacgccatccacatccacgagaaaggcgattgcagcgccgccgacgccagc
agcgccggcggtcacttcaatccggccgggcagccgcacgggcaggtcgatcgcggcccg
catcacgccggcgacatggacaacctggtcgccaacgccgaaggcgtggcccaggtcaac
gcgcacgccagcggcgtcaccctcggcggcggcgcgccgaacgacatcgccggccgcggc
gtgatcgtccatgcctcggccgacgactacaagacccagccgaccggcaacgcgggtggg
cgactggcatgcggtgtgatcaagatcggtcgatag

DBGET integrated database retrieval system