KEGG   Lysobacter gummosus: LG3211_1636Help
Entry
LG3211_1636       CDS       T04163                                 

Definition
(GenBank) hypothetical protein
  KO
K12297  23S rRNA (guanine2445-N2)-methyltransferase / 23S rRNA (guanine2069-N7)-methyltransferase [EC:2.1.1.173 2.1.1.264]
Organism
lgu  Lysobacter gummosus
Brite
KEGG Orthology (KO) [BR:lgu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:lgu03009]
    LG3211_1636
Enzymes [BR:lgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.173  23S rRNA (guanine2445-N2)-methyltransferase
     LG3211_1636
    2.1.1.264  23S rRNA (guanine2069-N7)-methyltransferase
     LG3211_1636
Ribosome biogenesis [BR:lgu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    LG3211_1636
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: UPF0020 Methyltrans_SAM Cons_hypoth95 THUMP Methyltransf_25 MTS Methyltransf_11 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ALN90612
UniProt: A0A0S2G493
LinkDB All DBs
Position
1797479..1799791
Genome map
AA seq 770 aa AA seqDB search
MSKFYASCGKGLEYLLADELVALGCQRATAATAGANVEGSLADAQHAVLWSRLASRVLWP
IAEFDCPDEHALYAGVAALDWPSHMESVHTLAVDAHVSGEAITHARYAAQRVKDAVVDVM
RARTGARPDVDTETPDLRLNLVVRKGKAIVSIDLGGGPLHRRGWRQKQGEAPLKENLAAA
VLLRGQWPKVYAQGGSLLDPMCGSGTLLIEGALMAADVAPGLLRHGNLPPTRWRGFDFAG
WRAQCEAARAREFAGLAALRPAFAGSDIDPHAIRAARENEAMAGLAGAIEWSVASVESLQ
SLSLTQDRHSREGGNPATFGSDGDKALDSRVRGNDGLEDDAGQKSVDATSSAPETAPGLV
VCNPPYDARLAADAALYRALGDALKRIVPSWRASLLCGDPALAQATGLRASKKYQVFNGA
IECALIVCDPIARVGHAEQKAKAEDAAPQPLSEGAQMVANRLRKNLRKLKNWRQREAVTC
FRAYDADLPEYSAAIDVYLSDEAPPRTWLHVQEYAAPADIPEADQRRRLNELLAAAREVF
EVPRERLAVKTRSRGKGGSKYGQLDQRGEFVVVREGAARLRVNPFDYLDTGLFLDHRPMR
LRIAEESRGRRFLNLFGYTGAATVHAAVGGAQETTTVDLSATYLQWCSDNLRENGLGGAQ
HRLAQADAMQWLEADRGRYDLIFCDPPTFSNSARADDFDIQREHVRLLRAAVARLADNGV
LYFSNNFRRFRLDTDAIAQFARCEDISAQTIPPDFERDARIHRCWRLEPR
NT seq 2313 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagttctacgcaagctgcggcaagggcctggaatacctgttggccgacgaactg
gtcgccctgggttgccagcgcgccaccgccgccaccgccggcgccaacgtcgaaggcagc
ctcgccgatgcacagcacgcggtgctgtggtcgcgcctggccagtcgcgtgctgtggccg
atcgccgagttcgactgcccggacgaacacgcgctgtacgccggcgtcgccgccctggat
tggccctcgcacatggagagcgtgcacacgctcgccgtggacgcgcacgtttccggcgaa
gcgatcacccatgcgcgctacgccgcgcagcgggtcaaggacgcggtggtcgatgtgatg
cgcgcgcgcaccggcgcgcggcccgatgtggataccgaaacgccggatctgcgtttgaat
ctggtcgtgcgcaagggcaaggcgatcgtctcgatcgacctgggcggcggtccgctgcat
cgccgcggctggcggcagaagcagggcgaagcgccattgaaggaaaatctggccgccgcg
gtattgctgcgcgggcagtggccgaaggtctacgcgcagggcggatcgttgttggacccg
atgtgcggcagcggcaccttgctgatcgaaggcgcgctgatggccgccgacgtcgcgccg
ggtttgctgcgtcacggcaacctgccgccgacgcgctggcgcggtttcgatttcgccggc
tggcgcgcgcaatgcgaggccgcgcgcgcgcgcgagttcgccggactggccgcgctgcgt
ccggccttcgccggcagcgatatcgatccgcatgcgattcgcgcggcgcgcgagaacgaa
gcgatggcggggttggccggggcgatcgagtggagtgtggcgagcgtcgagtcgctgcag
tctttgtcgctgacccaggatcgtcattcccgcgaaggcggaaatccagcgactttcggg
tcagatggcgacaaggcactggattcccgcgttcgcgggaatgacggacttgaggatgac
gccggacaaaagagtgtagatgcgacgtcgagtgcgcctgagaccgctcccggactcgta
gtctgcaacccaccctacgacgcccgtctcgccgccgacgccgcgctctaccgcgctctg
ggcgatgcactcaagcgcatagtcccgtcctggcgcgccagcctgctgtgcggcgacccg
gccctggcccaggccaccggcctgcgcgcgagcaagaaataccaggtgttcaacggcgcg
atcgaatgcgcgctgatcgtctgcgatcccatcgcccgcgtcggtcacgccgaacagaaa
gccaaggccgaggacgccgcgccgcagccgctgagcgaaggcgcgcagatggtcgccaat
cgcctgcgcaagaatctgcgcaagctcaagaactggcgccagcgcgaagcggtgacgtgt
ttccgcgcctacgacgccgatctgccggaatactcggccgccatcgacgtctacctcagc
gacgaagcgccgccgcgcacctggctgcacgtgcaggaatacgccgcgcccgccgatatc
ccggaagccgatcagcgccgccgcctcaacgaactgctggccgcggcgcgcgaagtattc
gaagtgccgcgcgagcggctggcggtgaagacccgcagccgtggcaagggcggcagcaag
tacggacagctcgaccagcgcggcgaattcgtggtcgtgcgcgagggcgccgcgcgcttg
cgggtgaatcctttcgattacctcgacaccggcctgttcctcgatcatcggccgatgcgc
ctgcgcattgcggaagagtcgcgcggccggcgtttcctcaacctgttcggctacacgggc
gcggcgaccgtgcacgccgcggtcggcggcgcgcaggaaaccaccacggtggatctgtcc
gcgacctacctgcagtggtgttcggacaatctgcgcgagaacggcctgggcggcgcccag
caccggctggcgcaggccgacgcgatgcaatggctggaagccgatcgcggccgctacgac
ctgatcttctgcgatccgccgaccttctccaattccgcgcgcgccgacgacttcgacatc
cagcgcgaacacgtgcgcctgctgcgcgcggcggtcgcgcgtctggccgacaacggcgtg
ctgtatttctcgaacaacttccgccggttccgcctggacaccgacgcgatcgcgcagttc
gcccgttgcgaggacatcagcgcgcagacgattccgccggatttcgagcgagacgcacgc
atccaccgctgctggcggctggagccgcgctga

DBGET integrated database retrieval system