KEGG   Lysobacter gummosus: LG3211_3124Help
Entry
LG3211_3124       CDS       T04163                                 

Definition
(GenBank) glutathione S-transferase, C-terminal domain protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
lgu  Lysobacter gummosus
Pathway
lgu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:lgu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    LG3211_3124
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgu02000]
    LG3211_3124
Enzymes [BR:lgu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     LG3211_3124
Transporters [BR:lgu02000]
 Other Transporters
  Pores ion channels [TC:1]
   LG3211_3124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_2 GST_C_3 GST_N_4
Motif
Other DBs
NCBI-ProteinID: ALN92082
UniProt: A0A0S2G8E3
LinkDB All DBs
Position
complement(3466340..3467017)
Genome map
AA seq 225 aa AA seqDB search
MIKVHHLNNSRSQRVLWLLEELQLPYEIVRYQRDPKTMLAPPELRAIHPLGKSPVVELDG
QVLAESAAIIETLTERYDSQHQLSPPPHPLESEERRRYRYWLHYAEGSAMPPLLMSLVFA
RLKTAPMPFFAKPIARGIADKAMSSFVGPQLALHLGYIESELGQRPWFAGERFTAADIQM
SFPVEAAAARAGGKRPHTQAFVERIRARSAYQRAVEKGGPYSLLS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaggtccatcacctcaacaactcccgttcccagcgcgtgctgtggctgttggaa
gaactgcagcttccgtacgagatcgtccgctatcagcgcgatcccaagaccatgctggcg
ccgccggagttgcgcgcgatccatccgctgggcaaatcgccggtggtcgagctcgacggc
caggtgctggccgaatcggccgcgatcatcgaaaccttgaccgagcgctacgacagccag
catcagctctcgccgccgccgcatccgctggagagcgaggagcgcaggcgctatcgctac
tggctgcattacgccgagggctcggcgatgccgccgttgctgatgagtctggtgttcgcg
cgcctgaagaccgcgccgatgccgttcttcgccaagccgatcgcgcgcggtatcgccgac
aaggccatgtcgtccttcgtcggcccgcagttggcgctgcacctgggttatatcgaaagc
gagctgggccagcggccatggttcgccggcgagcgtttcaccgcggcggatatccagatg
agtttcccggtggaagccgcggccgcgcgcgccggcggcaagcgcccgcacacgcaggcc
ttcgtcgaacgcatccgcgcgcgttcggcctatcagcgcgcggtggaaaagggcgggccg
tattcgctgctgagctga

DBGET integrated database retrieval system