KEGG   Lactococcus garvieae Lg2: LCGL_0046Help
Entry
LCGL_0046         CDS       T01963                                 

Definition
(GenBank) phage infection protein
  KO
K01421  putative membrane protein
Organism
lgv  Lactococcus garvieae Lg2
Brite
KEGG Orthology (KO) [BR:lgv00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    LCGL_0046
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC2_membrane_3 ABC2_membrane DUF3533 APG17 Med9 TerB RPW8 DUF1993 HsbA
Motif
Other DBs
NCBI-ProteinID: BAK59506
UniProt: F9VGM3
LinkDB All DBs
Position
complement(54450..57155)
Genome map
AA seq 901 aa AA seqDB search
MKHIKNTGKLFILDWKRIFKNPIAIFLVVALMFIPSLYAWFNIKALWDPYANTSQLPIAV
YSDDRTEKFQDKSINIGDEVLKNLKENKQLGWKFVDSKQELDKGVKSGKYYAGIYLPENF
SKNLLSFTTGDIQKPKIVYSINEKINAIAPKITSKGASSLQSQISEEFIKTASSTLLKTF
NDIGYDIDKNMVSIQKIKNTILSTNDNLDTIDQYTQQVVDLHGKMPDLKAKLAKANEFID
YLPEVDALGQKVVQLDDSMPTVKNQLAIIMTLQEKIPEIQNAGKQIAMIDNDFASVEQTM
NEGIQEAKQGLTIIQQVQTALPDIRKLGNQANELASTTLDGATQLQNALPSITSSVEVTL
KALQNVADSTSSIVTTIRQAIADGQLTDEEKAKIDSLVKAYQASVPQQQEAIGNLIDFLQ
KAQESAGNNEFDATIKNLQDLSALLGDISTRLGKVNEFVQAGDISSIESYLDQIDALAKN
ISGLVGQINVPDITAKVQSVLTQLIATIKNAQGLLTKAQAIDFESLLSSTSKTVSNAITL
LEKYQKEMPAIKQEVHDANIMLNGNMNTIVNAINKGASLYQNDLPVVEQKLDKAADFVKN
DYPGIRKDLTETLGTVNEKMPDLEKALNQANDLIVNDWPGIKTGIRKAADAIRKGEKEVD
LGEIVKLLKLDATKESDFLTQPVEVQENAIYPIANNGSASTPFYTALCLWVGAVLFSSVA
VTGFHLEGKDKLLYSKREQFSARMLTFIVMGLGQALIVTLGNYFGLGVDVRNPVYSVLFA
LLIAITFMIMVYVLVALFGNIGKGIAIIILVLSISGGGGNYPIQVSGKFFQAINPYLPFT
HAVNLLRESAGGIYWPNAWLAIIILVAVSIVFLVAGLIFFPHLEKTSKKISEMTQRSHIF
H
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacatataaaaaatactgggaaactatttattctggattggaagcgtatctttaaa
aatccaatagcaatctttttagtggttgctttgatgtttattccatccttatatgcttgg
tttaatattaaagccctttgggatccttatgcgaatacttcacagctcccaatagcggtt
tatagtgatgaccgaacagagaaatttcaagacaaatcgattaatatcggtgacgaagtc
ctgaaaaacctcaaagaaaacaaacaactcggctggaagttcgttgactctaaacaggag
ttggataagggtgtcaaatctggtaaatactacgcaggtatctatctgccagagaatttc
tctaaaaatttgcttagcttcaccaccggggatatccagaagcctaaaatcgtttattcc
atcaatgaaaaaataaatgctattgccccgaaaattacttcaaaaggtgcgtcttcatta
caaagtcaaatttccgaagaatttattaaaacggcaagcagcacattacttaaaaccttt
aatgatatcggatatgacattgataaaaatatggtcagcatccagaaaattaaaaacaca
atcttatctaccaacgataatttagataccattgatcaatatactcaacaagtcgtggat
ttgcacggcaagatgcctgatttgaaagccaaacttgcgaaagcaaatgagtttattgac
tacttgcctgaggttgatgcactgggtcaaaaagtcgttcaattggacgacagcatgcca
actgtgaaaaatcagcttgcgattatcatgaccttgcaagaaaaaatacctgaaattcaa
aatgccggtaagcagatcgcaatgattgacaatgactttgcctctgttgagcaaacaatg
aatgaaggaatccaagaagccaaacaaggcttaaccatcatccaacaagtccaaactgcc
ttgccagacatccgcaaacttggcaaccaagccaatgaactggcttctaccactttagac
ggtgcaacacaacttcaaaatgctttgccaagtattacaagtagtgtagaagtgacttta
aaagctttgcaaaatgtggctgacagtacttcttctattgttactactataagacaagcc
attgcggatgggcaactcactgatgaggaaaaagcaaaaattgacagtctagtcaaagct
tatcaagcaagtgttccccaacaacaagaggccatcggaaatctcattgattttctccaa
aaagcgcaagaaagcgccggtaacaatgaatttgatgccactattaaaaacctacaggat
ttgagtgcactattaggtgacatcagtactagattaggcaaggttaatgaatttgttcaa
gctggagatatttcttctatcgagtcatacttagatcaaatagatgccctcgcaaagaat
atttctggtcttgttggtcaaataaatgtaccagatataactgcaaaagttcaaagtgtc
ctcacccaactcatcgcaaccatcaaaaatgctcaaggtctcttaactaaagcccaagct
attgattttgaatccttgctcagctcaacaagcaagacggtttctaatgcgattactttg
cttgaaaagtatcaaaaagaaatgcctgcgatcaaacaagaagttcacgatgccaatatt
atgcttaacggcaacatgaacacgattgtcaacgcgattaataaaggagcttcactttat
caaaatgacttgcccgttgtggagcaaaaacttgataaagccgctgattttgtcaaaaat
gattacccgggtattcgtaaagatttgacagaaactttagggacagtcaacgaaaaaatg
cctgatcttgaaaaagccttgaaccaagcaaatgaccttatcgtcaatgactggccagga
atcaaaacaggcattcgtaaagccgctgatgcgattcgcaaaggtgaaaaagaagtcgat
ttaggtgaaattgtaaaacttctaaaacttgatgcaacgaaagaaagtgacttcctgacc
caacctgttgaggttcaagaaaatgcgatctaccctatcgcaaataacggttcagccagt
acacctttctacactgcactttgcttgtgggtcggcgctgtgctcttctctagtgtcgct
gtaactggcttccacttagaaggtaaagataaactgctctactctaaacgtgaacaattc
tcagcacgtatgcttactttcatcgtgatgggactggggcaagcacttatcgttaccctg
gggaactatttcggtcttggtgtagacgtgcgtaatcctgtttatagtgtcttatttgcc
ttactgattgctataacctttatgattatggtttatgttctagtagctttgtttggaaat
atcgggaaagggattgccattattatcttggttctctctatttccggtgggggcggtaac
tatcctattcaagtctctggtaaattcttccaagcgattaacccttacttgccgtttacc
catgcggtcaaccttttacgggaatctgctggtggtatctattggccaaatgcttggctt
gccatcatcatcctcgtagccgtttctattgtctttttagttgctgggcttatcttcttc
ccacatctggaaaaaacctcgaaaaagatttcagaaatgacccaacgaagtcatatcttc
cactaa

DBGET integrated database retrieval system