KEGG   Lactococcus garvieae Lg2: LCGL_1061Help
Entry
LCGL_1061         CDS       T01963                                 

Definition
(GenBank) NADH-peroxiredoxin reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lgv  Lactococcus garvieae Lg2
Brite
KEGG Orthology (KO) [BR:lgv00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    LCGL_1061
Enzymes [BR:lgv01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     LCGL_1061
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 FAD_oxidored FAD_binding_3 Thi4 Glutaredoxin HI0933_like DAO AlaDh_PNT_C Thioredoxin_4 K_oxygenase NAD_binding_8 Thioredoxin_9 FMO-like
Motif
Other DBs
NCBI-ProteinID: BAK60521
UniProt: F9VDX0
LinkDB All DBs
Position
1080451..1081980
Genome map
AA seq 509 aa AA seqDB search
MLEENLKAQLKQYLELLENDIALRVKADPEDANGKKVRDFVNEIAEMSPRISVEEAKLVK
APGFSVVRKGEMRGIAFAGIPLGHEFNSLVLALLQVSGRAPKIEEDLKKRIQAIDKPYHF
ETYVSLTCHNCPDVVQALNIMSVLNENITHTMIEGGMFQDEVKSRGVMAVPTVFVNGEEF
SSGRMSLEEILNKLVGQAGSEEFDDKDPYDVLVVGGGPAGASAAIYAARKGIHTGVLAEK
FGGQPLETLGIENFIGTTYTEGPKLAAQLEEHVKAYPTDIMKTQRAVKLEKKDLLEVTLE
NGAVLQSKTVVLSTGARWRSLGIPGEEEFKNKGIAYCPHCDGPIFAGQKVAVVGGGNSGI
EAAIDLAGVVEHVTVLEFLPELKADKVLQEKLYSLENVTVLTNVETKAIHGTDKVESLDY
VERDTQKEVNLELSGVFILIGLVPNTEWLEGVVERNSRGEIIVDKQGATNVPGVFAAGDC
TDSAYKQIVIAMGSGATASLGAFDYIIRH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgttagaagaaaatcttaaagcacaactcaagcaatatttagagcttttagaaaatgat
attgcattacgcgtcaaggcagatcctgaagatgccaatggtaaaaaagtacgggatttt
gttaatgaaattgctgaaatgtccccacgcataagtgttgaagaagctaaattagtcaaa
gcacctggcttttctgtcgtccgcaagggagaaatgaggggcattgcttttgctggtatt
cctttaggtcatgaatttaactcgcttgttttggcacttttacaagtaagtggtcgtgca
ccaaagattgaagaagacctcaaaaaacgtattcaagctatcgataagccttatcatttt
gaaacttacgtcagtttgacgtgtcacaactgtccagatgttgtccaagccttgaatatc
atgagtgttcttaacgaaaatattacccacacgatgattgaaggtggcatgttccaagac
gaagtcaaatcccgtggtgtaatggctgtaccaacagtttttgttaatggtgaggaattt
tcaagtgggcgcatgagccttgaagaaatattaaataaactcgtgggtcaagctggaagt
gaagaatttgacgacaaagatccttatgatgttcttgttgttggtgggggtcctgcaggt
gcaagtgcggcaatttatgcagcccgtaaggggatacatacaggggttttagcagaaaaa
ttcggtggtcagccattagaaactctaggtattgaaaactttatcggtacaacttatact
gaaggtcctaagttggctgcccaactggaagagcatgtgaaagcctatccaaccgacatt
atgaaaacgcaaagggcagtcaaattagagaaaaaagatctgcttgaagtgacactggaa
aacggtgcagtccttcaatcaaagacagttgtattatcaacgggagcccgttggcgttca
ctcggtatcccgggcgaggaggaattcaaaaacaaaggaattgcttattgtccgcattgt
gatggcccgatctttgcaggtcaaaaagttgccgtagttgggggaggaaactctgggatt
gaagcagccattgatttagctggtgtagttgaacatgtgactgttttagaatttttacca
gaacttaaagcggataaagttttacaagaaaaactctattcattggaaaatgttaccgtt
ctaactaatgtagaaacaaaagctattcatgggacagataaagttgaaagtctagattat
gtcgagcgtgatactcaaaaagaagtaaacctcgaattatcaggtgtctttattcttatc
ggtcttgtccctaatacagagtggcttgagggagtagtagagcgtaactcacgaggcgaa
atcattgtcgataagcaaggggctactaatgtacctggtgtatttgctgcaggggattgt
acagattcagcttataaacaaattgtaattgctatgggaagtggtgcaacagcttcgcta
ggtgcctttgactatatcattcgtcactaa

DBGET integrated database retrieval system