KEGG   Lysinibacillus varians: T479_01800Help
Entry
T479_01800        CDS       T03062                                 

Definition
(GenBank) hypothetical protein
Organism
lgy  Lysinibacillus varians
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg His_kinase HATPase_c 7TMR-DISM_7TM HATPase_c_2
Motif
Other DBs
NCBI-ProteinID: AHN23929
UniProt: X2H2M1
LinkDB All DBs
Position
complement(353685..356708)
Genome map
AA seq 1007 aa AA seqDB search
MALRKPIVRHLLVILIIFIVLTIFRLLWLAYFTPSNNQPLAQAGVLDMRQQTLTEDEIYQ
INGEWLYYPEVLLKTPNSNETSSSIEQTVRKIPMQRGSATKQHFGTYRVKILLSANAHSN
HRYAIRVPAISTASALYINGKLAGQSGVVSSNPSTHKGQVAPYTIYFTAEQSEIDVILHV
SNFDTPSNMVIDKRLSFSSASAMMHHQFITQLSLVAISMLLILFALFSILVFLFIYRNKK
VLLFTVGFLLPLADELITYDRSILDWLHLDYVWSLKLSNLIYLGASYFFVQFIRVLLVRY
QQAKYFRWFTTLYALGALLIILLPIQWLHTANLAFFMLYVMSFLYVVVLALKEYIGNQES
SAFIAFTAIGTTNGIIWGLIKMSFVLDIPFYPFDYLMIALGFAGYWFKRFYENQQQINLL
VAKLQKDGEMKDEFLLSNAQKLWDPMNKMITLGQTIYDNPNNCFVMEDKQNLKYLIDIGR
SMSFTLNDIVDYTRLKDNNLHLHKKNVRIQGVVSGVFDMLRFIAVGKQIQMTSSIARDFP
LVLADEKRLIQILFNLLHSSIKNTNASSIEISATIERKMAVIYIKLTESGTNNPDINLHE
HLFSSDKGLSDNEEIHLSFLISKQLIELHGGSLLNKGADLLFTIPIVDVMEEIEQLDDER
TEDIHLQENNTQLKASATEKQFKILMVDDDPVNLTMMRSLFSATEYNITTITSSEKALDL
LRLQRWDLVIIDAMLPYISGYALIENIRQHYTLLELPILLLTARNNPEDVYTGFAHGAND
YVTKPINSLELKVRCRALIDLKYSINQQLHLETAWLQAQIQPHFLYNTLNTIASLSTIDP
DRMIDLMHQFGKYLHASFDVKNLQRVVPLRHELELVRSYLYIEQQRFGELLQIDWDIDEQ
IDVEIPPISLQTLVENALRHGVLKQKGGGTVCIRIKELADYVTVSVIDNGIGMDATTLAQ
LLSDTDITSRGIGLRNTDLRLKRIYGQRLQIKSTPNEGTTITFHIPK
NT seq 3024 nt NT seq  +upstreamnt  +downstreamnt
ttggcgttgagaaaacctatcgtaagacatttgctagttattttaatcatttttatcgtc
ttaacgattttccgtctactctggctagcatattttacaccttctaataatcaaccactt
gcacaagcaggtgttttagatatgcgccagcaaactttaacagaagatgagatctatcaa
atcaatggtgaatggctctattatcctgaagtgttgttaaaaacacctaacagcaatgag
acaagcagttccatcgaacaaactgtccgtaaaattcctatgcaaaggggttcagcgaca
aaacagcattttggtacatatcgtgtaaaaatcttattaagtgctaatgcccattcaaat
caccgttatgctatccgagttcctgccatttctactgcatcagcgctatatattaacggg
aaacttgcggggcagtctggagtagtgtcatcaaatcctagcactcataaaggacaggtc
gcaccttacaccatatatttcactgcagagcagtctgaaatcgacgtcattttacatgta
tccaattttgatactccctccaatatggttatagataaacgtctttcttttagctctgcg
tcagccatgatgcaccatcagttcattacacaattatcacttgtagctatttcgatgttg
cttattttatttgcgttatttagcattcttgtttttctctttatttaccgcaataaaaaa
gtgttgctgttcactgtcggctttcttttacctttagctgacgaacttattacttatgat
cgttcaatacttgattggttacatttggattatgtatggtcgttaaagctatccaatctt
atttatctcggtgcttcctatttctttgtacagtttattcgtgtcttattagtgcgctat
caacaagcaaaatatttccgatggtttacaacattgtatgccttaggcgcgctacttatt
atactcttacctattcaatggctacacacagctaacctagccttctttatgctttatgtc
atgtcatttttatatgttgttgtactggccttaaaagagtatataggaaatcaagaaagt
tcagcttttattgcatttacagctattggcacaacaaacggaattatatggggccttata
aaaatgtcttttgtattagacatcccgttttatccatttgactatttaatgattgcactg
ggctttgcaggttattggtttaaacgcttttacgaaaatcaacaacagattaatctgctt
gttgccaaattacaaaaagatggggaaatgaaagatgagtttttattaagcaatgcacaa
aagctttgggaccctatgaataaaatgattactttaggacaaacaatttatgataatcca
aacaattgttttgttatggaagacaagcagaatttaaaatatttaattgatataggacgc
agtatgtcctttacgctcaatgacatcgtggattatacacgattaaaagataataattta
caccttcataaaaagaatgtccgcattcaaggcgtggtgtctggcgtatttgatatgcta
cgttttattgctgtgggaaaacaaattcaaatgacatcttctattgcaagagacttccct
cttgtgctagccgatgaaaaacggcttattcaaattctgtttaatctgctacacagctct
attaaaaatacgaacgctagttcaatcgaaattagcgcaacaatagaaagaaagatggct
gtaatttatatcaaactgacagagtctggaacgaacaatcctgatattaatcttcacgaa
catctcttttcttctgacaaaggactttcagataatgaagaaattcatcttagttttttg
atttctaagcaactaattgaattacacggaggttcattacttaataaaggagcagatttg
ctttttactatacctattgtagatgtcatggaagagatagaacaattggatgatgagcga
acagaggatattcatttacaggagaataacacgcagttaaaagcttccgctactgaaaaa
cagtttaaaattttaatggtcgatgatgaccctgtaaacttaacaatgatgcgaagtcta
ttctctgctacagaatataatattacaaccattacaagtagtgaaaaggcactggattta
ttgcgtttacaaagatgggatttagtcattattgatgcaatgctcccttatatttctgga
tatgccttaattgaaaacattcgacagcattataccttgctagagctaccaattttattg
ttaactgctcgaaataatcctgaagatgtgtatactgggtttgcacatggggccaatgat
tatgtaacgaaacccattaattctttggaattaaaagtacgctgtcgtgcgttaattgat
ttaaaatatagcatcaatcagcagctacatttggaaactgcttggcttcaagcacaaata
cagcctcattttttatataatacacttaatacaattgcttcactgagtacaattgatcca
gatcgaatgattgacttaatgcatcaattcggaaaatatctccacgcaagcttcgatgta
aagaacctgcaacgagttgtacctctgcgtcatgaactcgaactcgtccgttcatatctt
tatatcgaacagcaacgttttggggaattattacaaattgattgggatattgatgaacaa
attgatgttgagattcccccaatttctttgcaaacgcttgtagaaaatgcattacgacat
ggtgtattaaaacaaaaaggtggcggcactgtttgtattcgaattaaagagcttgccgat
tatgtgaccgtcagtgtaattgacaacggtattggtatggacgccacgacattagcacaa
ttactatccgatacggatataacgagtagaggcattggattacgcaatacggacctacgt
cttaaaaggatttatggtcaaaggttacaaatcaaaagcactccaaacgaaggcacaacc
atcaccttccacatccccaaataa

DBGET integrated database retrieval system