KEGG   Lysinibacillus varians: T479_02015Help
Entry
T479_02015        CDS       T03062                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K22187  alpha-ketoglutaric semialdehyde dehydrogenase [EC:1.2.1.-]
Organism
lgy  Lysinibacillus varians
Pathway
lgy00040  Pentose and glucuronate interconversions
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    T479_02015
Enzymes [BR:lgy01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.-  
     T479_02015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: AHN20363
UniProt: X2GJL0
LinkDB All DBs
Position
405029..406516
Genome map
AA seq 495 aa AA seqDB search
MCVMEIKNYIGGKWVTHSHLQSIAVTNPANGEHLATIPLSTANEVTEAVAVAKAAQKSWA
LVPAPKRADYLYAIGQKMKDKKEYLATVLTKEMGKVIEEARGEVQEGIDMAYYMAGEGRR
LFGETTPSELANKFAMSVRAPIGVVGLITPWNFPVAIATWKSFPAIVAGNTFIWKPSNET
PMMAYEMGKIFEEVGLPKGVANIVFGTGPTVGTALIEHPDVKVISFTGSTSTGSKVAELG
GKHLKKISLEMGGKNAVIVMEDADLQLATEAILWSAFGTAGQRCTACSRVIVHKDVKEEL
ENRLLEAMQFLTIGDGLDETVKIGPVINRAALEKINHYVQIGKQEGASLLTGGKILNEAP
YDKGFYYEPTLFTNVKPHMIIAQEEIFGPVVSLIEVANLDEAIEVNNGVKFGLSSSIFSQ
NVNTIFRAQRDLDTGIVYINAGTTGAEIHLPFGGTKGTGNGHRDSGVAALDVYTEWKSIY
VDYSGKLQRAQIDTK
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
gtgtgtgtaatggagattaaaaactatatcggtggtaaatgggttacacattcgcattta
caaagtatagcagtgacgaatcctgcaaacggagagcacttagcaacaataccactttca
actgcaaatgaagtgacggaagcggtagctgtagcgaaggcagcacaaaaaagttgggca
cttgtgccagcaccaaagcgtgcagattatttatatgccatcggtcaaaagatgaaagac
aagaaagaatatttggcgaccgttttaacaaaagaaatgggtaaggtgattgaagaagct
agaggtgaggtacaggaaggaattgatatggcttattatatggcgggtgaaggtcgacgg
ttatttggagagacgacaccgtcagagcttgccaataaatttgctatgagtgtacgcgca
ccaataggcgtagtagggttaataactccttggaatttcccagtggcaattgctacgtgg
aaatccttccctgcaattgtcgctggcaatacatttatttggaaaccatcaaatgaaaca
ccgatgatggcttatgaaatggggaaaatttttgaagaggttggcttaccgaaaggagta
gcaaatattgtttttggtacagggccaactgtcggaacggcgctaatagagcatcccgat
gtaaaagtcatatcgtttaccggctctacctcaacaggaagtaaggtggcggaacttggc
ggcaaacatttaaagaaaatttcgctagagatgggcggcaaaaatgctgtcattgtaatg
gaggatgcagacttgcagctcgctacagaagcgatattatggagtgcatttggcaccgct
ggtcaacgatgtacagcatgtagtcgtgtaattgtgcataaagatgtaaaagaagaatta
gaaaatcgtctattagaagcaatgcagtttttaacaattggagacggtttggatgaaact
gtgaaaatcggtccagtcattaatagagcggcattagaaaaaattaatcattatgtacag
attggtaaacaagaaggtgcatccttattaacaggtggcaaaattttaaatgaagcacct
tatgataaagggttttactatgagcccacattgtttacaaatgtaaagcctcatatgatt
attgcacaggaagaaatttttggtccggtcgtctctcttattgaagttgcaaatttagat
gaagcaatcgaagtcaataatggtgtgaaatttggcttatcaagctctattttctcacaa
aatgtgaacacgattttccgcgctcaacgcgacttagatacaggtattgtttatatcaat
gcaggtacgacaggtgcagaaatccatttgccattcggcggaacgaaaggaacagggaat
ggacatcgagattccggtgtggcagcattggacgtttacacagaatggaagagcatctac
gttgactacagcggtaaattacaaagagcacaaatcgatacaaagtaa

DBGET integrated database retrieval system