KEGG   Lysinibacillus varians: T479_07870Help
Entry
T479_07870        CDS       T03062                                 

Definition
(GenBank) ABC transporter
  KO
K01990  ABC-2 type transport system ATP-binding protein
Organism
lgy  Lysinibacillus varians
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lgy02000]
    T479_07870
Transporters [BR:lgy02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   ABC-2 type transporter
    T479_07870
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_23 AAA_29 DUF4162 AAA_27 Adeno_IVa2 IstB_IS21 AAA_22 RsgA_GTPase AAA_16
Motif
Other DBs
NCBI-ProteinID: AHN21372
UniProt: X2GK13
LinkDB All DBs
Position
1663397..1664281
Genome map
AA seq 294 aa AA seqDB search
MNVIEIKNLTKTYGKARGIADVSFNVEQGEIFGFIGPNGAGKSTTIRTLLSLIYPTSGSA
TIFGKDCIQFAPEIKKEIGYLPSEIFYYDNMKVKDLLKYSASFYKKDCSKRMKELAKMMD
LDLNKKIDDLSLGNKKKVGIVQGLLHEPKLIILDEPTSGLDPLMQQKFFELLEEENKKGA
TILFSSHILSEVQRLCNRVAIIKEGKIVTVEKISTLQENNYKKFKVETDAPLDKNYFQID
GVNKLDIHNNVTSFLFKGNINTVMKKIADIEITNLWIEEPDLEEIFLHYYEKEV
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaatagaaattaaaaatctaacgaagacttacggcaaagcaaggggaatagct
gatgttagttttaacgttgaacagggtgaaattttcggatttattggacctaatggtgct
ggaaagtcgacaacaattcgcacattattatcgcttatttacccaacgagcggcagcgcc
acgatttttggcaaggactgcattcaatttgcaccagaaataaaaaaggagatcggctat
ttaccatcagaaatcttttactatgacaatatgaaagtaaaggacctattaaaatactca
gctagcttttataaaaaagattgcagtaagagaatgaaagagttagcaaaaatgatggac
ttggatctgaataaaaaaattgatgacctatctttaggaaacaagaagaaggtcggaatt
gttcaagggctcctccatgagccgaaactcattattttagatgaaccgacaagcgggcta
gacccattaatgcaacaaaaattctttgaactattagaggaagagaataaaaaaggtgct
acgatcttattttcgtcgcacatcctcagtgaggttcaaagattatgtaatcgtgttgcc
atcattaaagaaggtaaaattgtaacggtagaaaagattagtacgttacaagagaataac
tataaaaagtttaaagttgagacggatgcacccctagacaaaaattacttccaaatcgat
ggggtcaataaattagatattcacaataacgtaactagctttttatttaaaggtaatatt
aatacggtgatgaaaaaaatcgctgacattgaaattacgaatttgtggattgaagaacca
gaccttgaggagatctttttacattattatgagaaggaggtctaa

DBGET integrated database retrieval system