KEGG   Lysinibacillus varians: T479_17140Help
Entry
T479_17140        CDS       T03062                                 

Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
lgy  Lysinibacillus varians
Pathway
lgy00020  Citrate cycle (TCA cycle)
lgy00190  Oxidative phosphorylation
lgy00650  Butanoate metabolism
lgy01100  Metabolic pathways
lgy01110  Biosynthesis of secondary metabolites
lgy01120  Microbial metabolism in diverse environments
lgy01130  Biosynthesis of antibiotics
lgy01200  Carbon metabolism
Module
lgy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lgy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    T479_17140
   00650 Butanoate metabolism
    T479_17140
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    T479_17140
Enzymes [BR:lgy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     T479_17140
    1.3.5.4  fumarate reductase (quinol)
     T479_17140
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_16 Fer4 Fer4_17 Fer4_2 Fer4_18 Fer4_15 Fer4_4 Fer4_21 Fer2_4 Fer4_13 Fer4_3 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AHN22812
UniProt: X2GNX5
LinkDB All DBs
Position
complement(3376398..3377177)
Genome map
AA seq 259 aa AA seqDB search
MEIAANTGRMVKVEILRQDTQGGQGYWQKFEVPYRHGMNVISVLMEIQKNPVTENGEKTT
PVSWDMNCLEEVCGACSMVINGRPRQSCSTLIDQLTEPVRLEPMKTFPVVRDLQVDRDRM
FNALKKVKAWVPIDGTYDLGEGPRMPEGKRQWAYELSKCMTCGVCMEACPNVSEKASFIG
PAPLSQVRLFNTHPTGAMIKDERLNAIMGDGGLANCGNSQNCVAACPKGIPLTTSIASLN
RATTVQMFRNFFGSDHYVD
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggaaatcgcagctaatactggaagaatggtaaaagttgaaattttacgtcaagataca
caaggtggccaaggctactggcagaaattcgaagttccttaccgtcatggtatgaacgtt
atttctgtgttaatggagattcaaaaaaatccagtgactgaaaacggtgaaaaaactaca
ccagtttcatgggatatgaactgtcttgaagaagtttgtggcgcatgttcaatggtaatc
aatggtcgtccacgtcaatcatgttcaacactgattgatcaattgactgaaccagttcgc
cttgaaccaatgaaaactttcccggttgtacgtgacttacaagttgaccgtgatcgtatg
ttcaacgcactgaaaaaagtgaaagcatgggtaccaatcgatggtacttatgatttaggt
gaaggtccacgtatgccagaaggtaaacgtcaatgggcttatgaattatctaaatgtatg
acttgtggtgtatgtatggaagcatgtccaaacgtgtctgaaaaagcttcattcattgga
ccagcaccattatcacaagtacgtctatttaacactcacccaacaggtgcaatgattaaa
gacgaacgtttaaatgcaattatgggtgacggcggtcttgctaactgtggtaactctcaa
aactgtgtagctgcttgtcctaaaggtattcctttaacaacatctatcgcatctttaaac
cgtgcaacaacagtgcaaatgttccgtaacttcttcggttctgaccattacgttgactaa

DBGET integrated database retrieval system