KEGG   Lysinibacillus varians: T479_17145Help
Entry
T479_17145        CDS       T03062                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
lgy  Lysinibacillus varians
Pathway
lgy00020  Citrate cycle (TCA cycle)
lgy00190  Oxidative phosphorylation
lgy00650  Butanoate metabolism
lgy01100  Metabolic pathways
lgy01110  Biosynthesis of secondary metabolites
lgy01120  Microbial metabolism in diverse environments
lgy01130  Biosynthesis of antibiotics
lgy01200  Carbon metabolism
Module
lgy_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lgy_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    T479_17145 (sdhA)
   00650 Butanoate metabolism
    T479_17145 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    T479_17145 (sdhA)
Enzymes [BR:lgy01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     T479_17145 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     T479_17145 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C HI0933_like Pyr_redox_2 GIDA AlaDh_PNT_C FAD_oxidored NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AHN22813
UniProt: X2GR51
LinkDB All DBs
Position
complement(3377183..3378937)
Genome map
AA seq 584 aa AA seqDB search
MAKSKIIVVGGGLAGLMATIKAAEVGTEVDLFSLVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLANQPPVKGMCDAAPGIIHLMDRMGVMFNRTPEGLLDFRRFGGTL
MHRTAFSGATTGQQLLYALDEQVRSHEVAGLVNKYEHWEFLGVVIDDDGVCRGIVAQNMR
TEEIQSFRADAVIMATGGPGIIFGKTTNSVINTGSAASIVYQQGASYANGEFIQIHPTAI
PGDDKNRLMSESARGEGGRIWTYKDGKPWYFLEEKYPAYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFVGDDPRKLPMKIFPAVHYSMGGLWV
DYNQMTEIPGLFAAGECDYSQHGANRLGANSLLSAIYGGMVAGPNAVDYVKHLKKHAEDL
SQDIYDARVKEEQAKWDAIMKMDGTENAYLLHKELGELMTATMTVVRYNDQLEETYKKLG
EFQKRWENININDTQKWSNQGAHFTRQLKNMLYLAKVMTKGALLRNESRGAHYKPDFPQR
DDENFLKTTMAKFDPATGEPVITYQEVDVSLIPPRKRDYSAKGD
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaagcaaaataattgttgtcggcggcggtttagctggtctgatggcaacgatt
aaagcagctgaagttggtactgaagttgatttattctcattagttcctgtaaaacgctca
cactctgtatgtgcgcaaggcggaattaatggtgccgtaaatacaaaaggtgaaggggat
tctccttggattcactttgatgatacagtatatggtggggatttcttagcgaaccaacca
ccagttaaaggtatgtgtgatgctgcccctggtattattcacttaatggaccgtatgggt
gtaatgttcaaccgtacaccagaaggtttacttgatttccgccgtttcggtggtacgtta
atgcaccgtacagcattctcaggtgctacaactggtcagcaattactatacgcgttggac
gagcaagttcgttctcacgaagtagctggtttagttaacaaatatgaacactgggaattc
cttggtgttgttatcgatgatgacggcgtttgccgcggtatcgtcgcacaaaatatgcgt
acagaagaaattcaatcattccgtgcagacgctgttattatggcgactggtggccctggt
attatcttcggtaaaacaacaaactctgttattaacacaggttctgctgcttctatcgta
taccaacaaggtgcttcatacgcgaatggtgagttcattcaaatccacccaacagcgatt
cctggggacgacaaaaaccgtctaatgtcagaatctgctcgtggtgaaggtggccgtatt
tggacatataaagacggtaaaccttggtacttcttagaagaaaaataccctgcatatggt
aacttagtaccacgtgatatcgcaacacgtgaaattttcgacgtttgtgtaaaccaaaaa
cttggtatcaacggcgaaaacatggtgtacctagatctttctcataaagatccacatgaa
ttagatgtaaaacttggtggtatcattgaaatctacgaaaaattcgtaggtgatgaccca
cgtaaattaccaatgaaaattttccctgcagttcactactcaatgggtggattatgggtt
gactacaaccaaatgactgaaattcctggtctattcgcagcgggtgaatgcgattactct
caacatggtgcaaaccgtcttggtgctaactcattattatctgcaatttatggcggtatg
gttgctggtccaaatgcagtagattacgttaaacatcttaaaaagcatgctgaagattta
tcgcaagatatttatgatgcacgtgttaaagaagagcaagcgaaatgggatgctatcatg
aaaatggacggcacagaaaacgcttaccttcttcacaaagagcttggtgagttaatgacg
gctacaatgacagttgtacgctataacgaccaacttgaagaaacatataaaaaacttggt
gaattccaaaaacgttgggaaaacattaacatcaacgatacacaaaaatggagtaaccaa
ggtgctcactttacacgtcagctgaaaaacatgctttacctagcgaaagtaatgacaaaa
ggtgctttacttcgtaatgaatctcgtggtgcgcactataaaccagacttcccgcaacgt
gatgatgaaaacttcttaaaaacaacgatggcgaaattcgacccagctacgggcgagcca
gttatcacataccaagaagtagacgtttcattaatcccaccacgtaaacgtgactactct
gcgaaaggagactaa

DBGET integrated database retrieval system