KEGG   Lysinibacillus varians: T479_20825Help
Entry
T479_20825        CDS       T03062                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit B
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
lgy  Lysinibacillus varians
Pathway
lgy00970  Aminoacyl-tRNA biosynthesis
lgy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lgy00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    T479_20825
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:lgy03029]
    T479_20825
Enzymes [BR:lgy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     T479_20825
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     T479_20825
Mitochondrial biogenesis [BR:lgy03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    T479_20825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey
Motif
Other DBs
NCBI-ProteinID: AHN23397
UniProt: X2GQG6
LinkDB All DBs
Position
complement(4092556..4093983)
Genome map
AA seq 475 aa AA seqDB search
MNFETVIGLEVHVELKTNSKIFSPAPAHFGAEPNTNTTVIDLGYPGVLPVLNKNVVDFAM
RAALALNMEIEQETKFDRKNYFYPDNPKAYQISQFDKPIGKNGWIDIEVDGYTKRIGITR
LHMEEDAGKLTHAGDHSLVDFNRQGTPLVEIVSEPDIRTANEAYAYLEKLKSIIQYTDVS
DCKMEEGSLRCDANISIRPYGQEEFGTKTELKNLNSFNYVRRGIEHEELRQADVLLSGGV
IDQETRRFDEKTGKTILMRVKEGTDDYRYFPEPDLVRLSIDDEWLERVKSEIPELPDARK
KRYVEELGLTPYDAGVLVISKEISDFFEAMVADGADAKLSANWLMGDVSAYLNAEQKDLK
DTALTPENLAGMVKLITDGTISSKIGKKVFAELVENGGSAEDIVKAKGLVQISDESALLA
IVTEVLDNNAQSIEDFKNGKDRAIGFLVGQIMKATKGQANPPMVNKLLQQEIAKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgaactttgaaacagtcattggtttagaagtacacgttgagttaaaaacaaactcaaaa
atcttctcgccagcgccagctcacttcggtgctgaaccaaatacaaacacaacagtaatc
gacctaggctaccctggtgtcctacctgtcttaaataaaaacgttgtagatttcgcaatg
cgtgcagcacttgcattaaacatggaaatcgaacaagaaacaaaatttgaccgtaaaaac
tacttctatccagataatccgaaagcttatcaaatttcacaattcgataagccaatcggt
aaaaacggttggattgatattgaagtagatggttatacaaaacgtatcggtattacacgt
cttcatatggaagaagatgctggtaaactaacgcatgctggtgaccactcacttgtggac
tttaaccgtcaagggacgccgcttgtagaaatcgtgtctgagccagatattcgcacagca
aatgaagcgtatgcctaccttgaaaaattaaaatccattatccaatatacagatgtttca
gactgtaaaatggaagaaggttcactgcgctgtgatgccaacatttcgattcgcccatat
ggccaagaggaattcggtacaaaaacagagcttaaaaacctgaactcattcaactacgta
cgtcgtgggattgagcacgaagagttacgccaagcggacgtattactttcaggtggcgtg
attgatcaagaaacgcgtcgctttgatgaaaaaacaggtaaaacaattttaatgcgcgtg
aaagaaggaacagatgattatcgttacttcccagagcctgacttggtgcgtctgtcaatc
gacgatgaatggttagagcgcgttaaatcagaaattcctgaactgccagatgctcgtaaa
aaacgctatgttgaagaattaggcttaacaccttatgacgcgggcgtgcttgttatttct
aaagaaatttcggatttctttgaagcgatggtagctgatggtgcagatgcaaaactttca
gctaactggttaatgggcgatgtttcagcttatttaaatgctgaacaaaaagatttaaaa
gatacagcattaacaccagaaaaccttgctggtatggtgaagttaattacggacggtaca
atttcttctaaaatcggtaaaaaagtatttgctgaattagtagaaaatggcggttcagct
gaagacattgtaaaagcaaaaggtttagttcaaatttcagatgagagtgccttattagca
attgttacagaagtattagataacaatgcacaatcaatcgaggactttaaaaatggtaag
gatcgtgcaattggcttcttagtcggtcaaattatgaaagcgacaaaaggccaagcgaac
ccaccaatggttaataaattattacaacaagaaattgctaaacgctaa

DBGET integrated database retrieval system