KEGG   Legionella hackeliae: LHA_0649Help
Entry
LHA_0649          CDS       T03809                                 

Gene name
hprA
Definition
(GenBank) Glycerate dehydrogenase
  KO
K00018  glycerate dehydrogenase [EC:1.1.1.29]
Organism
lha  Legionella hackeliae
Pathway
lha00260  Glycine, serine and threonine metabolism
lha00630  Glyoxylate and dicarboxylate metabolism
lha00680  Methane metabolism
lha01100  Metabolic pathways
lha01110  Biosynthesis of secondary metabolites
lha01120  Microbial metabolism in diverse environments
lha01130  Biosynthesis of antibiotics
lha01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    LHA_0649 (hprA)
  09102 Energy metabolism
   00680 Methane metabolism
    LHA_0649 (hprA)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LHA_0649 (hprA)
Enzymes [BR:lha01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.29  glycerate dehydrogenase
     LHA_0649 (hprA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh XdhC_C AdoHcyase_NAD NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: CEK09737
UniProt: A0A0A8URM4
LinkDB All DBs
Position
I:complement(647550..648512)
Genome map
AA seq 320 aa AA seqDB search
MKKPNIVVLDSKPLINDGLSLDALYQLGEVSLYDKTPEELVIERALDAEIILTNKVKLRE
KHFSQLPQLRYIGETATGVDNIDVKAAAKHNIIVTNIPDYSTDSVAQHVFALLLTHTNHI
EAHNQSIQRGDWQSNPYFAYWLNPITELAGMTLGLMGYGRVAQKVASIANTLGMRVIAHK
PTPFSDNLATWVSEEELLAQSDVLSLHCPLTEATKHFINEDTLKHMKPAAILINTGRGGL
INESHLAHALKKKQISAAYLDVLSEEPPAADNPLIGLSNCIITPHIAWASVAARKRLLNI
VCENIIHFLNGQPINVIRAS
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaacctaacatcgttgttttggactcaaaaccactcattaacgacggcttgtct
ttagatgcactttaccaattaggcgaagtgagcctgtacgataaaactccagaggaattg
gttatagagcgtgctttagacgcagaaattatccttaccaacaaagtcaaattgcgtgaa
aaacattttagccaactaccacaacttcgttatattggagaaacagcaacaggggttgat
aatattgatgtgaaagcagcagccaaacacaacatcattgtcacgaatattcctgactac
agtaccgatagcgttgcccagcatgtttttgctttattgctgactcatactaatcatata
gaagcgcataatcaatccattcaacgaggtgattggcaatctaatccctattttgcttac
tggttaaatcctattaccgaattagcggggatgaccttgggtttaatgggttatggcaga
gtggctcaaaaagttgcctcaatagccaatacactcggcatgcgagtgattgcacacaaa
cccacgcccttttctgataatctggcaacctgggtcagcgaagaggagctgttagcacaa
agtgacgtcttaagtttgcattgcccattaaccgaagcgactaaacattttattaatgaa
gacacacttaaacacatgaaacctgcagccattcttattaacacaggccgaggtggctta
attaatgaatctcatttagcacatgccttgaaaaagaaacaaataagtgcagcctatcta
gatgttcttagtgaagaaccacctgcggctgacaatcctttaatcggtttatccaattgt
attattacaccgcacattgcctgggcctcagttgctgcacgaaaacgcttgctaaatata
gtctgtgaaaatattattcactttctcaatgggcaacccattaatgtaatacgtgcttca
taa

DBGET integrated database retrieval system