KEGG   Legionella hackeliae: LHA_1522Help
Entry
LHA_1522          CDS       T03809                                 

Gene name
legY
Definition
(GenBank) Glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
lha  Legionella hackeliae
Pathway
lha00500  Starch and sucrose metabolism
lha01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lha00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    LHA_1522 (legY)
Enzymes [BR:lha01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     LHA_1522 (legY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_15
Motif
Other DBs
NCBI-ProteinID: CEK10564
UniProt: A0A0A8UUV0
LinkDB All DBs
Position
I:complement(1577337..1578617)
Genome map
AA seq 426 aa AA seqDB search
MKRIFALSIYFFIATTHSAVFSPAEIKTLRQNFIVNIMDTGAVIASPSRYYPDYYYDWTR
DAAITMDLVETWYEKEKKPEDKARLFNYVHWVEQAQHQVDTLPGQDILGEPKFYLDGRAF
DGPWGRPQNDGPALRALTLIRFAHALIKNKEMDYVRTHLYNGGLNPKTMGAIKMDLEYIA
HHWQEKNYDLWEEVYGDHFFTAMVQRKALLEGAKLARELKEETTAAFYESKARLIEERLL
KHIDKENLIIQASLAPHPGPQKTYELDSAVMLAVLLGHTDDNPFLPDNFYVKNTVAALKD
QFKMLYPINDNHTDALLFGRYPGDTYDGYRNDGLGNPWFILTATIAEYHYKLATMLPNDE
EHRSLIEANRNQGDNYLKLIKHYAPNLLMSEQINLNTGIQQGAISLTWSYVAVLRAIDLR
EKIKLH
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaacggatttttgccttatcaatctatttttttattgccactactcattcggctgtt
ttctcaccggctgaaattaaaactttacgacaaaattttattgtcaatatcatggataca
ggagcagttattgcctcgccttcccgatattatcccgattattattatgattggacacgt
gatgcagcgatcacgatggatttagtagaaacctggtatgaaaaagaaaagaagccagaa
gataaagcacgactttttaactatgtgcactgggtagaacaggcacaacaccaagtcgat
acccttccaggacaagatattttaggtgaacccaaattttatttagatggacgtgcattt
gatggaccttggggacgtccacaaaatgacggcccagcacttagagcattaacattaatt
cgttttgcgcatgctctaattaagaacaaagaaatggattacgttcgtactcatctgtac
aacggtggattaaaccccaaaacaatgggagcgattaagatggatttagaatatatcgcc
catcattggcaagagaaaaactatgacctatgggaagaagtttatggcgatcattttttt
acagccatggttcaaagaaaagcattactcgagggtgccaaattagctcgggaactcaaa
gaagaaacaaccgctgctttttatgaaagtaaggctcgtctcattgaagaaaggctcctg
aagcatattgataaagaaaatctcattattcaagcaagtcttgcccctcatcctgggcct
caaaaaacgtatgaactagattcagcggtcatgcttgccgtgttactaggtcataccgat
gacaatccctttctccctgataatttttatgtaaaaaatactgttgcagccttgaaagat
caatttaaaatgctttaccccattaatgataatcataccgacgctttactgtttggtcgt
tatccaggtgacacttatgatggttatcgcaatgatggcttagggaatccctggtttatt
ttgactgcaacaatagcagagtatcattacaaattggcaaccatgcttcccaatgacgag
gaacaccgatccttgatcgaagcgaatagaaatcaaggtgacaattatttaaaacttatc
aaacattatgcaccgaacttgctgatgagcgaacaaatcaatctcaacaccggtattcag
caaggcgctatttccttaacctggagctatgtagcagtacttcgagcaattgatttgcgt
gagaaaattaagttgcattaa

DBGET integrated database retrieval system