KEGG   Lactobacillus helveticus KLDS1.8701: HUO_01885Help
Entry
HUO_01885         CDS       T03777                                 

Definition
(GenBank) potassium transporter
  KO
K03455  monovalent cation:H+ antiporter-2, CPA2 family
Organism
lhd  Lactobacillus helveticus KLDS1.8701
Brite
KEGG Orthology (KO) [BR:lhd00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    HUO_01885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Na_H_Exchanger TrkA_C TrkA_N DUF166
Motif
Other DBs
NCBI-ProteinID: AJY60797
UniProt: A0A0D5MGN6
LinkDB All DBs
Position
366005..367840
Genome map
AA seq 611 aa AA seqDB search
MAQLSLFLVILLALVIPIFMARFQISNVPTAVAEIIVGIVMGSSGFNLITSTHDLTFLSN
LGVILLMFLSGMEIDFDLLQRKNNPKGKSQAGKTVDPLKTAITAFIGIVVMAFVLAYILR
LTGLFSEVMLAAIILMTVALGVVIATLKEKNILGRPIGQTILLTAVLGEVIPLLLLMIYA
SVNGGNAEQLWLIILLFAAAIFLLRRFKQPYLWFAKITKATTQLDIRLAFFLIFALVTVA
ERVGAENILGAFLAGMVMKLLEPSEATKDKLTSIGYGFFIPIFFIMTGVRLNLRSLFAHP
SSLMLLPVLVIFLFIAKAPVVLTYMRYFQKKNAFAGGFLTATTITIVLPTLQVARKLHAI
TSTQSDAFILAAVIVCILSPIVFNSNFVLLPEDKIKEKVAIVGANAVTVPVAHDLHANWY
SVKMFTDKKNQYKTYDSRVENLTFLPNLDEETLEKGGVFDGDIVVAANRADEDNIKIARM
AKEKGVNRVIARLSEVDSKTLTEFNEKGIEVFNSTNVHAALMRAMIESPTVYRIMTDTKN
ILYSVKVKNTHYTGRQLMDLEFIDQITVSRIKRGDEWLIPRGATEIEPEDILVFSGEFKV
ADRVRDLLSKE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atggcacaattatcactatttttagtaattttgttagcgctagtcattccaatatttatg
gcgcgctttcagattagtaatgtaccaaccgcggttgccgaaattattgtcggcatcgtc
atgggatccagcggttttaacctaattacatcaacgcatgatctaacctttttatctaat
ctaggtgtgatcttattgatgtttttatctgggatggaaattgattttgatttattacaa
agaaaaaataatcctaaaggaaagtcgcaagcaggaaagacggtcgatcctttaaagact
gcgattactgcctttatcggaatcgtggtcatggcttttgttttagcctatatcttacgg
ctcaccggattgttcagtgaagtcatgttggccgccattatcttgatgactgtggcactt
ggtgtggttatcgccaccttgaaggaaaagaatatcttaggtcgcccaatcggacagact
attttgctaactgccgtacttggtgaagttattcctttgcttttgttaatgatttacgca
tctgttaatggtggcaacgctgaacaattatggttgattattctgttgtttgctgccgca
attttcttgttgcgacgcttcaagcaaccatatttgtggtttgccaagatcacgaaggca
actactcagctagatattcggttagcctttttcctaatttttgcattagtaaccgttgct
gaaagagttggtgctgaaaatatcttaggtgcctttttagcagggatggtcatgaagctg
cttgaaccaagtgaagctactaaggataagttgacctcaattggttatggtttcttcatt
ccgattttcttcattatgacgggtgtaagacttaacttgcggtcactttttgcacaccca
tcttcattgatgttattgccagttttggttattttcttatttattgctaaagcaccagtt
gttctaacttatatgcgttatttccaaaagaagaatgcttttgctggtggctttttgacg
gcaacgaccattacgattgtgttgccaaccttgcaggttgcacgaaagttgcacgcaatt
acatcaactcaatcagatgcctttattttggctgcggtaattgtctgcattttgagtccg
attgtctttaactctaactttgttttattgccagaagacaagatcaaggaaaaggtggca
attgttggtgctaacgctgttactgtgccagtggcgcatgatttgcatgctaactggtat
tcagtcaagatgttcactgacaagaagaatcaatataagacttacgatagtcgagtagag
aacttaacctttttgccaaatctagatgaggaaacgcttgaaaaaggtggcgtgttcgat
ggcgatatcgtggtagcggccaatcgcgcggacgaagacaatattaagattgctcgaatg
gcaaaagaaaagggcgtaaatcgtgtaattgcccgacttagcgaagttgatagcaagact
ctgaccgaatttaatgaaaaaggaattgaagtctttaattctaccaatgtgcatgccgca
ttgatgagagcgatgatcgagtcgccaactgtctacagaattatgaccgacacgaagaat
attttgtattctgtcaaagtgaagaatactcattatacaggtcgtcaactgatggacttg
gaatttattgatcagattacggtaagtagaattaagcgtggggatgaatggctgattcca
cgcggcgcgactgagattgagccggaagatattttggtcttctctggcgaatttaaggta
gcagatcgtgttcgtgatttgttgagtaaggaatag

DBGET integrated database retrieval system