KEGG   Lactobacillus helveticus DPC 4571: lhv_0143Help
Entry
lhv_0143          CDS       T00625                                 

Definition
(GenBank) D-alanine-D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lhe  Lactobacillus helveticus DPC 4571
Pathway
lhe00473  D-Alanine metabolism
lhe00550  Peptidoglycan biosynthesis
lhe01100  Metabolic pathways
lhe01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lhe00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    lhv_0143
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    lhv_0143
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    lhv_0143
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lhe01011]
    lhv_0143
Enzymes [BR:lhe01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     lhv_0143
Peptidoglycan biosynthesis and degradation proteins [BR:lhe01011]
 Precursor biosynthesis
  Amino acid ligase
   lhv_0143
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATP-grasp_4 GARS_A ATPgrasp_ST CPSase_L_D2 TTL
Motif
Other DBs
NCBI-ProteinID: ABX26408
UniProt: A8YWP6
LinkDB All DBs
Position
144431..145513
Genome map
AA seq 360 aa AA seqDB search
MTKKTQVGLIFGGNSSEYEVSIVSCRNIYKAIDKEKFDVHPIWITNEGYFANEEESFKVL
EDPSYQVKNPHKVHNISNLIELENLPEIDVFFPIVHGNLGEDGVLQGLFRLMNKPFVGDD
VLAAAVTMDKEFTKILAQRVGVPVADWITIKRFEYDDKNNDKLDYEKVAEKLGRDMFVKP
SNQGSSVGVSHVTNADEYAAALKEAFKYDDKVLVEETVPGTEVETAVLGNDKPIVAGVGQ
ITNAKGSFYSYKNKYDDNSTSKLQIPADLPQEIIDTVRRNARKVYEVTECSGMARIDSML
TPGGKVVLTEVNALPGFTNISMYPKLFEEAGVPYTELITRLIEVGMERFDHKKTLLHKHD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaacacaagttggattgatttttggtggtaactcatcagaatatgaagta
tcaattgtttcatgtcgtaatatttataaagcaattgataaagaaaaatttgatgtacac
ccaatttggattactaatgaaggctactttgcaaatgaagaagaaagtttcaaggtttta
gaagatccttcataccaagtaaagaacccacacaaggttcacaatatttctaatttaatt
gaattagaaaacttaccagaaattgatgtctttttccctattgttcacggtaacttgggt
gaagacggcgttttacaaggtttattccgtttgatgaataagccattcgttggtgatgac
gtcttggctgctgccgtaaccatggacaaagaatttaccaagattttagctcaaagagtt
ggcgttcctgttgctgactggatcacaattaaacgttttgaatacgatgacaaaaataat
gataaacttgattatgaaaaagttgctgaaaaacttggccgtgacatgtttgttaagcca
tctaaccaaggttcatcagttggtgttagccatgtaactaacgctgatgaatatgcagca
gcattaaaagaagcatttaagtacgatgacaaggtattagttgaagaaactgttcctggt
actgaagtagaaactgccgtactaggtaacgacaagccaattgtagcaggtgtgggacaa
atcaccaatgcaaaaggctcattctacagctataagaacaaatacgatgacaattcaact
tctaagttacaaatccctgcagatttgccacaagaaattattgacaccgtaagaagaaat
gctcgtaaagtttatgaagttaccgaatgtagtggtatggctagaattgactctatgctt
actccaggtggtaaagtagtattgactgaagttaatgctcttccaggctttactaatatc
agtatgtatcctaagttgtttgaagaagcaggtgttccttacactgagttaattactcgt
ttgattgaagtaggaatggaacgttttgatcataagaagactttgcttcataagcacgat
taa

DBGET integrated database retrieval system