KEGG   Lactobacillus helveticus DPC 4571: lhv_1402Help
Entry
lhv_1402          CDS       T00625                                 

Definition
(GenBank) Serine-threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
lhe  Lactobacillus helveticus DPC 4571
Brite
KEGG Orthology (KO) [BR:lhe00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:lhe01001]
    lhv_1402
Enzymes [BR:lhe01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     lhv_1402
Protein kinases [BR:lhe01001]
 Serine/threonine kinases: Other
  Bacterial family
   lhv_1402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Kinase-like RIO1 Haspin_kinase Seadorna_VP7 Kdo DUF3899 Synaptobrevin
Motif
Other DBs
NCBI-ProteinID: ABX27389
UniProt: A8YVV9
LinkDB All DBs
Position
complement(1386206..1388203)
Genome map
AA seq 665 aa AA seqDB search
MLGERYRIIDTLGEGGMANVYLAEDIILQRKVAVKILRLDLQNEPQTQARFKREALATSE
LSHPNIVSVLDVGTDHGLHYMVMEYVDGPDLKEYIHQNAPLDLHEVIRIMDKILSAVALA
HKHNVIHRDLKPQNILMDKRGNIKIADFGIAVALNQSSVTQTNSVMGSVHYMSPEQTRGG
LVTKQSDIYSLGIILYELITGTVPFNGDTPVSIALKHAQEPIPSIRKKDHSVPQALENVV
LRATAKDPRDRYATAQAMQADLDSSLNPERADEPVFVPNHGNNNDKTIVLPGFKAPEKEQ
PTESDEETKPDKKEKKKDFWQNVKSHKWWWIFSIIATGLIIFIMIFALSGSNNKPHQVHI
PDVTNITEKSAEKKLEAAGLQIGKVVKRQSDDIKKGHVIGTKPAAGNSMDQGKAIILIVS
SGSSMVKVPNVVGDNYDEAAEKLENQGFDVVREDQYSNKVARDNIISQSIAAGVEVKPTQ
TTITLVVSRGKKVKPKINTVTLKDLHNYSLKSAQDYAKEHGLTLQINQEYSDEVEKGLVI
SMQPEAGTKVERGSTVTIKVSRGPKEEKDTTITKTFTVNYIGTDLNNDDKSDSKSWDASN
KEDSSKGDHVQIYIKDDEHSLSNIYRDLYIKRDMSFSIPFSLKNGNGQLRVVRNRETVLN
EKVTK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
ctgcttggtgaacgctatcgcattattgatactttaggcgaaggcggtatggctaatgtc
tatctagccgaagatattattctgcaacgcaaagttgcggttaaaatcctgcggttagat
ttacaaaatgaacctcaaactcaagctcgttttaaaagagaagctttagccacgagtgaa
ttaagtcatcctaatattgtttctgttcttgatgtaggcactgatcatggattgcattat
atggtaatggaatatgttgatggtcctgatttaaaagaatatattcaccaaaatgctcct
ttagatttgcatgaagtaattcgcatcatggacaaaatcctgagcgctgttgctctggcc
cataaacataatgtgattcaccgtgatctcaagccgcaaaacatcctgatggataagaga
ggcaatattaagattgctgatttcggaattgcggttgccttgaatcagagctctgttaca
cagactaattctgttatgggatcagttcattatatgtcgcccgaacagactagaggcggg
ttggttactaagcagtcagacatttattctttaggaattattttgtatgaattgattaca
ggaaccgtgccatttaatggtgatactcctgtttcgattgccttaaaacacgcgcaggaa
ccgataccttctattcgaaagaaggatcatagtgttccgcaagccttagaaaatgttgtt
ttaagggctactgctaaagatccgcgagatcgttatgctacagctcaagcaatgcaggct
gatttagatagcagtttaaatccagaacgggcagacgagccggtttttgtacctaatcat
ggaaataataatgataaaacaatcgttttgcctggctttaaagctccagaaaaagagcag
ccgacagaatctgatgaagaaactaaacctgataaaaaagaaaagaaaaaagatttttgg
cagaatgtaaagagccataaatggtggtggatcttttcaatcattgctacaggattaatt
atctttattatgatctttgcactaagtggaagtaataataaaccacatcaagtgcatatt
ccagatgtgaccaatataactgaaaaaagtgccgaaaagaaattagaagctgctggcttg
caaataggcaaggtggttaagcgacaatctgatgatattaaaaaaggacatgtcatcggt
actaaaccagctgcaggtaatagcatggatcaaggaaaagctattattttgatcgtatct
agtggttcaagcatggtaaaagttcctaatgtagttggggataattatgatgaagctgca
gaaaagctggaaaatcaaggctttgatgtagttagagaagaccagtattcaaataaagta
gctagagataatattatttctcaaagtattgctgctggggtagaagtaaaaccaacgcag
acaactattactttagtggtctctcgtggcaaaaaagtaaagccgaagataaacactgta
accttgaaggatctgcacaattattcattgaagagtgcacaggactacgctaaagaacat
ggtttgactttacagattaatcaagaatattctgatgaagttgaaaaaggcctggttatc
tcaatgcaaccagaggctggtaccaaggtggaacgtggatctaccgtaacaattaaggtt
tcacgcggtccaaaggaagaaaaagatactactattactaagacatttactgttaattat
ataggcaccgatctcaataatgatgataaatccgatagcaagagttgggatgcttctaat
aaagaagacagcagcaaaggtgatcatgttcagatttatatcaaagatgatgagcactcg
ttaagtaatatctatcgtgacttgtatattaaacgtgatatgagtttttcaattccattt
tctcttaagaatgggaatggtcaattacgagtagttcgtaatagagaaactgttttaaat
gaaaaggtgacaaaataa

DBGET integrated database retrieval system