KEGG   Leptotrichia hofstadii: JCM16775_1967Help
Entry
JCM16775_1967     CDS       T06149                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulfide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
lhf  Leptotrichia hofstadii
Brite
KEGG Orthology (KO) [BR:lhf00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    JCM16775_1967
Enzymes [BR:lhf01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     JCM16775_1967
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA FAD_binding_2 HI0933_like FAD_oxidored Lycopene_cycl DAO Thi4 K_oxygenase AlaDh_PNT_C NAD_binding_8 NAD_binding_9 3HCDH_N FMO-like FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: BBM39256
UniProt: A0A510JJ70
LinkDB All DBs
Position
complement(1999975..2000958)
Genome map
AA seq 327 aa AA seqDB search
MDFSLNLGALDEGKLVKIDENKLYDVTVVGSGPAAVSAAIYAARKGLNVAMIGVKIGGQV
LDTNEIENIIGTVLTTGAKFAETLEKHLKEHEIAFKEGHLVKEIKEDGKDKILVTDDGKS
YKTKTVIVATGAKPRSLNIPGEAEYVGKGVHYCSTCDGPFYKGLDVAVIGGGNSGVEAAL
DLSGIAKSVTLIEFMPELKADKVLQEKLAEQPNIKTILNSATVRVNGNEFVESIVYKSRE
TDEEKTLNVEGMFVEIGLSPRSEVVKDLAETNKIGEIVINPENNSTSVAGIFAAGDVTSI
RQKQIIIAMGEGAKAALGAFEYLITKY
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggattttagcttgaatcttggtgctttagatgaagggaaattagtaaaaattgatgaa
aataagctttacgatgtaactgtagttggttctgggcctgcggctgtctctgcagcaatt
tatgcggctagaaaaggacttaatgtggcaatgattggagtgaagattggtggacaggtt
cttgatacaaatgaaattgagaatattatcggaactgttttgacaactggagctaaattt
gctgaaacattggaaaaacatttaaaagaacatgaaattgcgtttaaagaagggcatttg
gtaaaagagatcaaggaagatggaaaagataagattttggtaactgatgatggaaaaagt
tataaaacaaaaacagttattgtagcaactggggcaaaacctagaagtctaaatattcct
ggagaagctgagtatgtaggaaaaggggtgcattactgctcaacttgtgacggacctttt
tataaaggattagatgtggctgtaattggtgggggaaattcaggtgtggaagcagcgctt
gatttatctggaattgcaaaatcagttacattaatcgaatttatgccagaattaaaggca
gataaagttctgcaggaaaaactggctgagcagccaaatataaaaacgattttaaattct
gcaacagttagagttaatggaaatgaatttgtggaaagcattgtttataaaagcagagaa
actgatgaagaaaaaacattgaatgtagaaggcatgtttgtggaaattggattgtcgcca
agaagcgaagttgtaaaagacttggctgaaacaaataaaattggggaaattgtaattaat
cctgaaaataattcaacttctgtggctggaatctttgctgcgggagatgttactagcatt
agacaaaaacaaataattatcgcaatgggagaaggtgcaaaagcggcactaggagcattt
gagtatctgattacaaaatattaa

DBGET integrated database retrieval system