KEGG   Lactobacillus heilongjiangensis: JP39_00830Help
Entry
JP39_00830        CDS       T04057                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lhi  Lactobacillus heilongjiangensis
Pathway
lhi00473  D-Alanine metabolism
lhi00550  Peptidoglycan biosynthesis
lhi01100  Metabolic pathways
lhi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lhi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    JP39_00830
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    JP39_00830
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    JP39_00830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lhi01011]
    JP39_00830
Enzymes [BR:lhi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     JP39_00830
Peptidoglycan biosynthesis and degradation proteins [BR:lhi01011]
 Precursor biosynthesis
  Amino acid ligase
   JP39_00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp_3 ATP-grasp ATP-grasp_4 GARS_A RimK
Motif
Other DBs
NCBI-ProteinID: ALB28035
UniProt: A0A0K2L9T8
LinkDB All DBs
Position
197597..198652
Genome map
AA seq 351 aa AA seqDB search
MKIVVLSGGRSTERNVSLSSGVKITNALRSKGYEVAYVDSFLGKDVDEDKIDDLFTTEPE
SESKLIIDDEVLTDEKINALRTDGTRGLLGRNVLKICQHADIVYMGLHGEDGENGKMQAV
FDVFDIRYTGSGSLASGLAMDKKYSKEIFVQDKIPTAQYTTTKTAKILSEDIPFNYPMVV
KPSNGGSSVGTHIVRNATELRESVADALRFDSEVLIEEYIKGREFSVAIVDGLVLPAVEV
TVDTGWYDFQHKFQENNVTHFITPPDNLDDEIHAKMQALTKKTFESLGMSNYGRVDFLLR
DGQLYVMEANTLPGMTPLSLMPREAEAAGISYPDLCERIIKSKVKYYENRQ
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgtcgttctttcaggtggaagaagtacagaaagaaatgtttctttatcttcc
ggagttaaaatcaccaacgcactacgtagcaagggttatgaagtcgcatacgttgattca
tttttaggtaaggatgttgatgaagataagattgacgatctttttacaactgaaccagag
agtgaaagcaaacttatcattgatgatgaagttttaactgatgaaaaaatcaatgcactt
cgtaccgatggaactcgtggtcttttgggccgtaatgttttgaaaatttgtcaacacgcc
gatatcgtctacatgggacttcacggtgaagatggcgaaaatggtaagatgcaagcagta
tttgatgtctttgatattagatatacaggtagtggctcacttgcttcaggtcttgccatg
gataagaagtattctaaagaaatttttgttcaagataagattccaacagctcaatataca
acaactaagacagctaagatcttgtctgaagatattccgttcaactatccaatggtagtt
aaaccatcaaacggtggttcaagtgttggtacacatatcgttagaaatgcgactgaattg
agagaatcagtggccgatgctttgagatttgatagcgaagttttgattgaagaatatatc
aagggtcgcgaattctcagttgccatcgttgatggattagtacttccagcagtcgaagtt
accgttgatacaggttggtatgatttccaacacaagttccaagaaaacaatgtgacacat
ttcatcacaccaccagataacttggatgatgaaattcatgctaagatgcaagctttgaca
aagaagactttcgaatcattaggcatgagcaattatggtcgtgtggacttcttgttacgt
gacggtcaattgtacgtcatggaagcaaacactttgccaggtatgacaccgttgtcattg
atgccaagagaagcagaagctgccggcatttcataccctgacttatgtgaaagaatcatt
aagagtaaagttaagtattacgaaaatcgtcaatag

DBGET integrated database retrieval system