KEGG   Laribacter hongkongensis: LHK_00034Help
Entry
LHK_00034         CDS       T00884                                 

Gene name
proC
Definition
(GenBank) ProC
  KO
K00286  pyrroline-5-carboxylate reductase [EC:1.5.1.2]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00330  Arginine and proline metabolism
lhk01100  Metabolic pathways
lhk01110  Biosynthesis of secondary metabolites
lhk01130  Biosynthesis of antibiotics
lhk01230  Biosynthesis of amino acids
Module
lhk_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lhk00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    LHK_00034 (proC)
Enzymes [BR:lhk01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.2  pyrroline-5-carboxylate reductase
     LHK_00034 (proC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: P5CR_dimer F420_oxidored
Motif
Other DBs
NCBI-ProteinID: ACO73030
UniProt: C1D9D1
LinkDB All DBs
Position
30037..30846
Genome map
AA seq 269 aa AA seqDB search
MMDITFIGGGNMATAIIGGLCRLPDTHIRVVEPGADKRAMLAERFGVTPLEEPPAAWSAD
CIVVLAVKPQQLKAVCATLAPRLQGALVVSIAAGVDVATLSRWLGGSERIVRVMPNTPAM
IGKGMSGLYAAPAVSESDRQAAEAILQAVGQTRWVATEAGIDDVIAISGSGPAYVFHFVE
ALEATGRQLGFDEATARELALATFEGAIELLRQSGEPAGDLKRKVMSKGGTTERAIASFE
ADGVAEAIVRGALACRARAVEMSEEFSRS
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
gtgatggatatcacctttatcggcggcggcaacatggcaaccgccatcatcggcggcctg
tgccggctgcctgacacgcatatccgggtggtggagcccggtgccgacaagcgggccatg
ctggccgagcgctttggcgtgacgccgctggaagagccgccggctgcatggtctgctgac
tgcatcgtggtgctggcggtcaagccgcagcagctcaaggccgtatgcgccacgctggcg
ccccggttgcagggcgcgctggtggtgtcgatcgctgccggtgtggacgtggccacgctg
tcgcgctggctgggtggcagcgagcgcatcgtgcgcgtcatgcccaatacgccggccatg
atcggaaagggcatgtccggcctgtacgccgcaccggctgtcagcgaaagcgaccggcag
gccgccgaagccatcctgcaggccgtgggccagacacgctgggtggccaccgaggccggc
attgatgacgtcatcgctatttccggcagcgggccggcctacgtgttccattttgtcgag
gcactggaggccactggccgccagctcgggtttgacgaggctaccgcccgtgaactggcg
ctggccacctttgaaggtgccatcgagctgttgcgccagagtggcgagccggccggtgac
ctcaagcgcaaggtgatgagcaagggcggcacgacggaacgcgccatcgccagctttgag
gccgatggcgtggccgaggccatcgtgcgcggtgcgctggcctgccgtgcccgtgccgtg
gaaatgtccgaagaattcagccggagctga

DBGET integrated database retrieval system