KEGG   Laribacter hongkongensis: LHK_00239Help
Entry
LHK_00239         CDS       T00884                                 

Definition
(GenBank) Translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
lhk  Laribacter hongkongensis
Brite
KEGG Orthology (KO) [BR:lhk00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:lhk03012]
    LHK_00239
   03029 Mitochondrial biogenesis [BR:lhk03029]
    LHK_00239
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lhk04147]
    LHK_00239
Translation factors [BR:lhk03012]
 Eukaryotic Type
  Elongation factors
   LHK_00239
 Prokaryotic Type
   LHK_00239
Mitochondrial biogenesis [BR:lhk03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    LHK_00239
Exosome [BR:lhk04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   LHK_00239
  Exosomal proteins of breast cancer cells
   LHK_00239
  Exosomal proteins of colorectal cancer cells
   LHK_00239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ACO73234
UniProt: C1DAQ3
LinkDB All DBs
Position
237559..238749
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTILSKKFGGEAKDYAAIDSAPEERARG
ITINTAHVEYETEGRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLARQVGVPYIIVYLNKADMVDDAELLELVEMEVRELLSSYDFPGDDLPIVTGSALKALE
GDQSEIGEPSIFRLADALDSYIPTPERAVDKPFLLPIEDVFSISGRGTVVTGRVERGIVK
VGEELEIVGLKPTVKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLSKPGS
ITPHTDFVAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDVTGAVTLPEGIEMVMPGDNVQ
MNVALIAPIAMEDGLRFAIREGGRTVGAGVVAKIIK
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggctaaagagaagttcgaacggactaagccgcacgtgaacgtcggtaccatcggccac
gttgaccacggcaagaccacgctgactgctgcgatcacaaccattctgtcgaagaaattc
ggtggcgaagccaaagactacgcagccatcgacagcgcaccggaagagcgtgcacgtggc
attaccatcaacaccgcccacgttgagtacgaaaccgaaggccgccactacgcacacgtc
gactgcccggggcacgccgactacgtgaagaacatgattaccggtgctgcccagatggac
ggcgccatcctggtgtgctcggccgctgacggtccgatgccgcaaacccgcgaacacatc
ctgctggcccgccaggtcggtgtgccgtacatcatcgtctacctgaacaaggccgacatg
gtggacgacgccgagctgctcgagctggtggaaatggaagtgcgcgaactgctgtcttcc
tacgacttcccgggtgacgatctgccgatcgtgaccggttcggccctgaaagccctggaa
ggcgaccagtccgaaatcggcgaaccgtcgatcttccgtctggccgacgctctggacagc
tacatcccgactccggagcgcgctgtcgacaagccgttcctgctgccgatcgaagacgta
ttctcgatctccggccgtggcaccgtggtgaccggtcgcgtcgagcgcggtatcgtcaag
gttggcgaagaactggaaatcgtgggtctgaagccgaccgtcaagaccacctgcaccggc
gtggaaatgttccgcaagctgctggaccagggtcaggctggtgacaacgtgggcgtgctg
ctgcgtggcaccaagcgtgaagacgtcgagcgtggccaggtgctgtccaagccgggctcc
atcactccgcacaccgacttcgtcgctgaagtgtacgtgctgagcaaggaagaaggcggt
cgtcacactccgttcttcaacggttatcgtccgcagttctacttccgtacgactgacgtg
accggtgccgtgaccctgccggaaggtatcgagatggtgatgccgggtgacaacgtgcaa
atgaacgttgccctgatcgcgccgatcgccatggaagacggcctgcgcttcgccatccgc
gaaggtggtcgtaccgtgggtgccggtgtcgtcgccaagatcatcaagtaa

DBGET integrated database retrieval system