KEGG   Laribacter hongkongensis: LHK_02634Help
Entry
LHK_02634         CDS       T00884                                 

Gene name
fbpA
Definition
(GenBank) FbpA
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
lhk  Laribacter hongkongensis
Pathway
lhk02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:lhk00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LHK_02634 (fbpA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:lhk02000]
    LHK_02634 (fbpA)
Transporters [BR:lhk02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    LHK_02634 (fbpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: ACO75615
UniProt: C1DCJ6
LinkDB All DBs
Position
2505350..2506348
Genome map
AA seq 332 aa AA seqDB search
MMKLTGLTLATLATLASAVATAEEITVYSARNEQLIKPLFDAYSKETGVQVRFITDKEGP
LMARLAAEGKNTPADILMTVDAGNLWQAANAGLLKPVHSRTLEQNVPAHLRDPKGQWFGL
AVRARTIFFNTRTVKPADLSSYEALADPKWRGRLCLRTSKKVYNQSLVGMMMAEHGAAKT
EQIVKGWVRNLATAPFPDDTKMLEAIAVGQCDVGIANTYYYGRLMDKQPKLPLGIFWANQ
QTSGTHVNIAGAGVTTHAKNEKGAVRFLEWLSSDKAQNLFADINMEYPVNPKVKPAAEVA
AWGDFKHNYINVSKAGEMQAEAVKLMDRAGYR
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaactcaccggcctgactctcgcaaccctggctacactggcctccgccgtggcc
actgccgaagaaatcaccgtgtactccgcccgtaacgagcagctgatcaagccgctgttc
gacgcctacagcaaggaaaccggcgtccaggtacgtttcatcaccgacaaggaaggcccg
ctgatggcgcggctggctgccgagggcaaaaacaccccggccgacatcctgatgaccgtc
gatgccggcaacctgtggcaggcggccaatgccgggctcctcaagccggtgcattccagg
acactggagcagaacgtgcccgcacacctgcgcgaccccaagggacaatggttcgggctg
gccgtacgggcccgcacgatcttcttcaacacccgcaccgtcaaaccggccgacctctcc
agctacgaagcgctggctgatcccaagtggcgcggccggctgtgcctgcgcacctccaag
aaggtctataaccagtcgctggtcggcatgatgatggccgaacacggtgcggccaaaacc
gaacagatcgtcaagggctgggtccgcaacctggccaccgcaccgttcccggacgacacc
aagatgctggaagccatcgccgtcggccagtgtgatgtcggcatcgccaacacctattac
tacggccgcctgatggacaagcagcccaaactgccactgggcattttctgggccaaccag
cagacctccggcacccatgtcaacatcgccggtgccggcgtcaccacccatgccaaaaac
gaaaagggagccgtccgtttccttgaatggctgtcgtccgacaaggcacaaaacctgttt
gccgacatcaacatggaatacccggtcaatccgaaggtcaaaccggcagcagaagtggct
gcctggggcgatttcaagcataactacatcaacgtgtccaaagccggcgaaatgcaggcc
gaagcggtcaagctgatggatcgtgccggttatcgctga

DBGET integrated database retrieval system