KEGG   Laribacter hongkongensis: LHK_03053Help
Entry
LHK_03053         CDS       T00884                                 

Gene name
ddlB
Definition
(GenBank) DdlB
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00473  D-Alanine metabolism
lhk00550  Peptidoglycan biosynthesis
lhk01100  Metabolic pathways
lhk01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lhk00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LHK_03053 (ddlB)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LHK_03053 (ddlB)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    LHK_03053 (ddlB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lhk01011]
    LHK_03053 (ddlB)
Enzymes [BR:lhk01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LHK_03053 (ddlB)
Peptidoglycan biosynthesis and degradation proteins [BR:lhk01011]
 Precursor biosynthesis
  Amino acid ligase
   LHK_03053 (ddlB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp_3 ATP-grasp CPSase_L_D2 ATP-grasp_4 TTL ATPgrasp_ST ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: ACO76031
UniProt: C1D5L4
LinkDB All DBs
Position
complement(2964682..2965608)
Genome map
AA seq 308 aa AA seqDB search
MNETMKSRFGKVAVMMGGNSCEREISLMSGQGVLNALRGQGVDAHAFDPAEKPLAALQSE
GFDRVFIALHGAFGEDGTLQGALETMGIPYTGCGVMASAIGMDKWRSKLVWKAAGLPVPD
FRLLADDSDFAAIEAELGLPMFVKPACEGSSLGVTKVRKAGELAQAYAEARKFDPLVLAE
QFVGGGEYTVALLEGRALPAIKIEPATEFYDYDAKYFRDDTVYRCPAGMDDEHELAMRRL
AEQGFAVLGGSGWGRIDFLVDEAGQPYLLEINTAPGMTTHSLVPMAAREAGLTYEALCLK
VLEAAHVG
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaatgaaacaatgaagtccagatttggcaaagtcgccgtgatgatgggaggcaactcc
tgcgagcgcgaaatctcgttgatgagcgggcagggggtgctgaacgccctgcgcgggcag
ggcgtggacgcccatgcctttgatccggccgaaaagccgcttgccgccttgcagtcggaa
ggctttgaccgtgtgttcatcgccctgcacggggcgtttggtgaagacggcaccctgcaa
ggggcgctggaaaccatgggaattccctacaccggctgcggcgtgatggcctcggccatc
ggcatggacaaatggcgctccaagctggtgtggaaggctgccgggctaccggtgccggat
ttccgcctgctggccgatgacagtgattttgccgcgattgaggcggagctgggcctgccc
atgttcgtcaagccggcctgcgaaggctccagcctcggtgtgaccaaggtccgcaaggcc
ggcgaactggcacaggcctacgccgaagcacgcaagttcgatccgctggtgctggccgag
cagtttgtcggagggggcgaatacaccgtggccctgctggaaggccgggccctgccggcg
atcaagatcgaaccggccaccgagttttacgattacgacgccaagtattttcgtgatgac
accgtgtaccgttgtccggccggaatggatgacgaacacgagctggccatgcgccgtctg
gccgagcagggctttgccgtgctcggtggcagcggctgggggcggatcgactttctcgtc
gacgaggcggggcagccgtatctgctggagatcaatactgcaccgggcatgacgacccac
agcctggtgccgatggccgcacgcgaggccgggctgacttacgaagccctgtgcctcaag
gtgctggaagcggcacatgtgggataa

DBGET integrated database retrieval system