KEGG   Laribacter hongkongensis: LHK_03062Help
Entry
LHK_03062         CDS       T00884                                 

Gene name
ftsI
Definition
(GenBank) FtsI
  KO
K03587  cell division protein FtsI (penicillin-binding protein 3) [EC:3.4.16.4]
Organism
lhk  Laribacter hongkongensis
Pathway
lhk00550  Peptidoglycan biosynthesis
lhk01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:lhk00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LHK_03062 (ftsI)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    LHK_03062 (ftsI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lhk01011]
    LHK_03062 (ftsI)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:lhk03036]
    LHK_03062 (ftsI)
Enzymes [BR:lhk01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     LHK_03062 (ftsI)
Peptidoglycan biosynthesis and degradation proteins [BR:lhk01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   LHK_03062 (ftsI)
Chromosome and associated proteins [BR:lhk03036]
 Prokaryotic Type
  Chromosome partitioning proteins
   Divisome proteins
    LHK_03062 (ftsI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ACO76040
UniProt: C1D5M3
LinkDB All DBs
Position
complement(2974903..2976678)
Genome map
AA seq 591 aa AA seqDB search
MRVGSIHTPRDSRRPGATPRQAARPVLAEGRVRLVGLGLLTLFLLLLGRALYLQVVSQDF
LQDQGSARYSRVLRLEATRGMITDRNNEPLAISSPVESIWASPADMDPVPAAQVARLARL
LDMPADLIGRRLADKRREFVYLKRQISPELAREVMALGIPGISTQPEFRRFYPAGEITSH
LVGYTGIDGQGMEGMELTRESMLAGAAGRRHVIKDRRGHVVEDIAAIERPRDGQTLTLSI
DRRIQYLAWRELKVAMEKSNAKAASMVVLDARTGEVLALVNLPTFNPNSRSSMAPELRRN
HAVIDIYEPGSTLKPFAIAKALDAGLVRPNQVFETLPYMIGPARIRDTHDYPALDVAGVL
QKSSNVGSSKIALLLPPHDLWQFYSDLGFGRRPQSGFPGEAAGMLRPWKHWRPIEQATMS
YGHGISVSLLQLVRAYTIFTNDGVLLPLSFTRLAQPLPGRQVLRPETARKVRDMLVSVTQ
PGGTATRAQVLGYTVGGKTGTSRKLENGRYVTSKYVASFAGFVPASRPRLIAAVMLDEPD
TSGGQYYGGISAAPVFSRVMAGSLRVLGIEPDAPTHNTLLPADMPVVKEET
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcggttccattcacacgccacgggacagccgtcgtcccggcgccacgccgcgc
caggctgcgcgtcccgtgctggccgaaggccgggtgcggctggtcggcctcggcctgctg
acgctgtttttgctgctgctggggcgggcactgtacctgcaggtcgtgtcgcaggacttt
ttgcaggaccagggatcggcccgctacagccgggtgctgcggctggaagccacccgcggc
atgatcaccgaccgcaacaacgagccgctggcaatttcctcgccggtggagtcgatctgg
gccagtccggccgacatggacccggtgccggccgcacaggtggcgcggctggcgcgcctg
ctggacatgccggctgacctgatcggccgccggcttgccgacaagcggcgcgaatttgtt
tacctcaagcggcagatttcgcccgagctagcccgcgaagtgatggcgctgggcattccc
ggcatcagtacccagccggagttccggcgtttttacccggccggcgaaatcacctcgcac
ctggttggctataccggcatcgatggtcagggaatggaaggcatggagctgacgcgcgag
tcgatgcttgccggtgctgccggccgccgtcacgtgatcaaggaccggcgcggccatgtc
gtcgaggacatcgccgccatcgagcggccgcgtgacggccagacgctgacgctgtcgatc
gaccggcgcatccagtatctcgcctggcgcgaactgaaggtggcgatggaaaaatccaac
gccaaggctgccagcatggtggtgctcgacgcccgcaccggcgaggtgctggccctggtc
aacctgccgaccttcaaccccaacagccgctccagcatggcgccggagctgcgccgcaac
catgcggtcatcgacatctacgaaccgggttcgaccctcaagccgtttgccatcgccaag
gcgctggatgccgggctggtccggcccaaccaggtgttcgagaccctgccgtacatgatc
ggcccggcgcgcatccgcgatacccacgactatccggcgctggacgtggccggggtgctg
caaaagtcgtccaacgtcggttcgagcaagattgccctgctgctgccaccgcatgatctg
tggcagttctattccgacctcggcttcggccggcgtccgcagtccggctttccgggcgag
gcagccggcatgctgcggccatggaagcactggcggccgatcgagcaggccaccatgagc
tacggccacggcatcagcgtcagcctgttgcagctggtgcgggcctataccatcttcacc
aacgacggcgtgctgctgccgctgtcgttcacccggctggcgcagccgctgccggggcgt
caggtgctcaggccggaaacggcgcgcaaggtgcgcgacatgctggtcagcgtgacccag
cccggcggcacggccacccgggcgcaggtgctcggctataccgtcggcggcaagaccggc
acctcgcgcaagctcgaaaacggccggtacgtcaccagcaagtacgtcgcctcgtttgcc
ggcttcgtgcccgccagccggccgcgcctgattgcagcggtgatgctcgacgaaccggac
acgtccggcggccagtactacggcggcatttccgcggcaccggtattcagccgggtgatg
gcgggcagcctgcgcgtgctgggcatcgagccggatgcgccgacccacaataccctcctg
ccggccgacatgccggtcgtgaaagaagaaacatga

DBGET integrated database retrieval system