KEGG   Lactobacillus helveticus H10: LBHH_0318Help
Entry
LBHH_0318         CDS       T01959                                 

Definition
(GenBank) Phosphoglycerate mutase 1 family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lhl  Lactobacillus helveticus H10
Pathway
lhl00010  Glycolysis / Gluconeogenesis
lhl00260  Glycine, serine and threonine metabolism
lhl00680  Methane metabolism
lhl01100  Metabolic pathways
lhl01110  Biosynthesis of secondary metabolites
lhl01120  Microbial metabolism in diverse environments
lhl01130  Biosynthesis of antibiotics
lhl01200  Carbon metabolism
lhl01230  Biosynthesis of amino acids
Module
lhl_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lhl00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LBHH_0318
  09102 Energy metabolism
   00680 Methane metabolism
    LBHH_0318
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LBHH_0318
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:lhl04131]
    LBHH_0318
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:lhl04147]
    LBHH_0318
Enzymes [BR:lhl01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     LBHH_0318
Membrane trafficking [BR:lhl04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    LBHH_0318
Exosome [BR:lhl04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   LBHH_0318
  Exosomal proteins of melanoma cells
   LBHH_0318
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 Sugar-bind
Motif
Other DBs
NCBI-ProteinID: ADX69550
UniProt: F0NV56
LinkDB All DBs
Position
329474..330154
Genome map
AA seq 226 aa AA seqDB search
MAKLVLVRHGESVANAANVYTGWNDVPLTKKGEQQAKKAGELINTISDFAPTHIHTSVLS
RAIVTANIVAETCNLLWLPMTKTWRLNERHYGALRGLNKDISRKVFGVEQVLLWRRSFDS
VPPKQGSPVIARRYKLCDQHLMPRAESLHQTQKRLMPYYYDHIASRLLNGEDQLIVAHGS
SLRALIKKLENINNHDIVNLEVPNAEPIVYTMDEQLNIVKKEILRS
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaattagtattggttcgacacggtgaaagtgttgctaatgccgcaaatgtttat
acgggctggaatgatgtgccgttaaccaaaaaaggtgagcaacaagctaaaaaagcaggt
gaattgattaatactatttctgattttgcaccaacgcatattcatacttctgttttgtcg
cgtgctattgtaacagccaatatcgtagctgagacgtgcaatctcttatggctacctatg
actaagacgtggcgtttaaatgaacggcattatggcgccttaagaggccttaacaaggat
atctcacgtaaagtctttggcgtagagcaagttttattatggcggcgcagttttgactct
gttccgccaaagcaaggctcgccagttatcgctcgacgttataagttgtgtgatcaacat
ttaatgccgcgtgcggagagtttgcatcaaacacaaaagcgactaatgccatattattat
gatcacattgcttcaagattgcttaatggtgaggatcaattaatagtagctcatggttca
agtttgcgagctttaattaaaaaattagaaaatattaacaatcacgatattgtaaacttg
gaagtgcctaacgcagaaccaattgtttatactatggatgagcagttaaatattgttaaa
aaagaaatactgaggagttaa

DBGET integrated database retrieval system