KEGG   Lactobacillus hokkaidonensis: LOOC260_104200Help
Entry
LOOC260_104200    CDS       T03598                                 

Definition
(GenBank) peptide ABC transporter permease
  KO
K03305  proton-dependent oligopeptide transporter, POT family
Organism
lho  Lactobacillus hokkaidonensis
Brite
KEGG Orthology (KO) [BR:lho00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    LOOC260_104200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTR2 MFS_1
Motif
Other DBs
NCBI-ProteinID: BAP84987
UniProt: A0A0A1GRN9
LinkDB All DBs
Position
444372..445868
Genome map
AA seq 498 aa AA seqDB search
MENKKNVDTAFLGQPRGLSTLFFTEMWERFSYYGMRAILLFYMYYAVSKGGLGFDQGTAA
SIMSIYGSLVYMSSVVGGWLSDRVWGSRRTVFIGGVFIMFGHIALSVPFGAPALFVSIAL
IVIGTGLLKPNVSEMVGGLYSSTDKRRDAGFSMFVFGINLGAAVAPWAVPFAANGFGFHA
FGNEMNFHVGFSLAAIGMFLGLIQYYFGGKKYLSKESLYPQDPIEKENMRPIIIWTTVGV
VALLVIIALLGVTGNLNVSNIIWIITIIAIALPIFYFVMMLSSKKVTKIEHSRVWAYVPL
FIAAAIFWAIEESGSVVLALFAANRTVLHIGGWHFAAANFQTLNPLFIMILTPFFVWLWS
NWRNQPSAPGKFSVGLMFAGASYLFMALPGIINGTAGRVSPWWLIGSWFIVEIAEMLISP
IGLSVTTKLAPKAFQSQMMSMWFLADAAGQAVNAQIVKFYSANTEVSYFLIIGLVSVAFG
ILLLFLVKPIHRLMDGVD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaataaaaaaaatgtcgatactgcctttttaggacaacctagaggtttatctaca
ttgttcttcactgaaatgtgggaacggtttagttattatggtatgcgagcaattctgcta
ttttacatgtattatgctgtctctaaaggtggtttaggtttcgatcaaggaactgccgca
tcgattatgtctatctatggttcattagtatatatgtctagtgttgttggtggttggctt
agtgaccgtgtctgggggagccgtcgaacggtatttatcggtggagttttcatcatgttt
ggtcatattgcactgtcggtaccttttggtgcaccagcactttttgtttcaattgcattg
attgttattgggacaggtctactaaagccaaacgtttctgaaatggttggtgggttatat
tcatcaactgataagaggcgtgatgccggtttcagtatgtttgtctttggaattaactta
ggagctgcagttgctccttgggcagtaccatttgctgctaatggttttggttttcatgca
tttggaaatgagatgaactttcacgttgggttctccctggctgcaatcggaatgtttttg
ggattaatacagtattattttggtgggaagaaatatctttctaaagaaagtttatatcca
caagatccaattgaaaaagaaaatatgcgtcctattattatttggacaacggttggtgtt
gttgcattgttggtcatcattgctttattaggtgtgactggtaacctgaatgtcagcaat
ataatttggataatcacaattatagcaattgcactaccaatcttttactttgtaatgatg
ttgagtagtaaaaaagttacaaaaattgaacattcacgtgtttgggcttatgtaccactt
ttcattgccgcagcaatcttttgggcaattgaggaatcaggctcagttgttttagcatta
tttgctgctaaccgaactgtcctgcacatcggtggttggcattttgcagctgccaacttc
caaacactaaatccgttattcatcatgatcttaacgccattctttgtttggctgtggagt
aactggagaaatcagccaagtgcacctggtaagttctcagttggacttatgtttgctggt
gcatcatatttattcatggcacttcctggaattattaatggaacggctggtcgtgttagt
ccatggtggttaatcggatcttggtttattgttgaaattgctgaaatgctaatctcgcct
attggattatccgtcactaccaaacttgcgccaaaagcgttccaatcacaaatgatgagt
atgtggttcctagcggatgctgctggtcaagctgtgaatgctcaaattgttaaattctat
agtgccaacactgaagtatcttacttcttaattattggactggttagtgtagcatttggt
attctattgctattcttagttaaaccaattcatagattaatggatggtgtagattaa

DBGET integrated database retrieval system