KEGG   Lactobacillus hokkaidonensis: LOOC260_115730Help
Entry
LOOC260_115730    CDS       T03598                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lho  Lactobacillus hokkaidonensis
Pathway
lho00473  D-Alanine metabolism
lho00550  Peptidoglycan biosynthesis
lho01100  Metabolic pathways
lho01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lho00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    LOOC260_115730 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    LOOC260_115730 (ddl)
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    LOOC260_115730 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lho01011]
    LOOC260_115730 (ddl)
Enzymes [BR:lho01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     LOOC260_115730 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:lho01011]
 Precursor biosynthesis
  Amino acid ligase
   LOOC260_115730 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATPgrasp_ST ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: BAP86083
UniProt: A0A0A1GYM3
LinkDB All DBs
Position
complement(1529698..1530843)
Genome map
AA seq 381 aa AA seqDB search
MQTNRKIHVALLFGGNSSEHDVSKRSAHNIYDAMDKQKYDVSLFMFTKDGILLGNAASKR
IFNGEAEDQVVADEYPKIDMHNPLAPILALQEVQDVDIFYPVIHGNLGEDGTVQGLFKLL
KKPYIGSNVLASALSFDKDMTKRILTQAGVRNTKYLLVTPENKAEMTWAKISGELGETVF
IKPANQGSSVGIHRATNEQEYNDGLADAFNYDFKILVEEAIQGPKEIEISILGNEAPRAS
KLGAVKVPDSDPFYDYQNKFVDASGVVFELPVVLPAELTNEITQMALTAYVALGMKGLSR
IDFLVDENNVPYLSEPNTLPGFTNISLYPQMWEVSGISYSELIDQIIQYGLDEYKRNSEI
KYDFEELGTEHVGKKEYNNDK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
atgcagacaaatcgaaagattcatgtagcactcctttttggtggcaattcgtctgaacat
gatgtttctaaacgttcagcccataatatttacgatgcaatggacaaacaaaagtatgat
gtaagtttgttcatgtttaccaaagatggaattctattaggaaacgcggcttcaaaacga
atttttaatggtgaagcagaagatcaggttgttgcggatgaatatccaaaaattgatatg
cacaatccattagcaccgatcttggcgctacaagaagtacaagatgtggatattttttat
ccagtaattcatggtaatttaggtgaagatggtacggtccagggactattcaaattgcta
aaaaagccgtacattggttccaatgtcttggcatccgcattgtcgtttgataaagatatg
actaagcggatcctgactcaagcgggtgtgcgcaatactaagtacttactggttacacct
gaaaataaggcggaaatgacttgggctaagattagcggtgaattgggtgagactgtcttt
attaagccagccaaccaaggatcttcagttggaattcatcgtgctactaatgagcaagaa
tataacgatggtttggctgatgcatttaactatgacttcaaaattttggtcgaagaagcg
attcagggaccaaaagaaattgaaatttcaattttaggtaacgaggcgccacgcgcatct
aaattaggtgccgttaaagttccagatagtgatcctttttatgattatcaaaacaagttt
gttgatgcaagtggggttgtctttgaactaccagtggtgttaccagcagagttaacgaat
gagatcacacagatggcgctaacagcttacgttgcgttaggaatgaagggcctgtctcga
attgactttttggttgatgaaaacaacgtaccatatttaagtgaacccaatacgttgcct
ggctttactaatatcagcctgtatccacaaatgtgggaagtttctgggattagttattca
gaattaattgatcagattattcaatatggattggatgagtacaagcgcaatagtgaaatt
aagtatgactttgaagaattaggtactgaacacgttggtaaaaaagaatataataatgac
aaatag

DBGET integrated database retrieval system