KEGG   Lactobacillus helveticus R0052: R0052_00795Help
Entry
R0052_00795       CDS       T02217                                 

Gene name
ddl
Definition
(GenBank) D-alanine-D-alanine ligase Ddl
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
lhr00473  D-Alanine metabolism
lhr00550  Peptidoglycan biosynthesis
lhr01100  Metabolic pathways
lhr01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:lhr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    R0052_00795 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    R0052_00795 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    R0052_00795 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:lhr01011]
    R0052_00795 (ddl)
Enzymes [BR:lhr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     R0052_00795 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:lhr01011]
 Precursor biosynthesis
  Amino acid ligase
   R0052_00795 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp ATPgrasp_ST ATP-grasp_4 GARS_A CPSase_L_D2 TTL
Motif
Other DBs
NCBI-ProteinID: AFR21191
LinkDB All DBs
Position
138122..139204
Genome map
AA seq 360 aa AA seqDB search
MTKKTQVGLIFGGNSSEYEVSIVSGRNIYKAIDKEKFDVHPIWITNEGYFANEEESFKVL
EDPSYQVKNPHKVHNISNLIELENLPEIDVFFPIVHGNLGEDGVLQGLFRLMNKPFVGDD
ILAAAVTMDKEFTKILAQRVGVPVADWIAIKRFEYDDKNNDKLDYEKVAEKLGRDMFVKP
SNQGSSVGVSHVTNADEYAAALKEAFKYDDKVLVEKTVPGTEVETAVLGNDKPIVAGVGQ
ITNAKGSFYSYKNKYDDNSTSKLQIPADLPQEIIDTVRRNARKVYEVTECSGMARIDSML
TPGGKVVLTEVNALPGFTNISMYPKLFEEAGVPYTELITRLIEVGMERFDHKKTLLHKHD
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgactaaaaaaacacaagttggattgatttttggtggtaactcatcagaatatgaagta
tcaattgtttcaggtcgtaatatttataaagcaatcgataaagaaaaatttgatgtacac
ccaatttggattactaatgaaggctactttgcaaatgaagaagaaagtttcaaggtttta
gaagatccttcataccaagtaaagaacccacacaaggttcacaatatttctaatttaatt
gaattagaaaacttaccagaaattgatgtctttttccctattgttcacggtaacttgggt
gaagacggcgttttacaaggtttattccgtttgatgaataagccattcgttggtgatgac
atcttggctgctgccgtaaccatggacaaagaatttaccaagattttagctcaaagagtt
ggcgttcctgttgctgactggatcgcaattaaacgttttgaatacgatgacaaaaataat
gataaacttgattatgaaaaagttgctgaaaaacttggccgtgacatgtttgttaagcca
tctaaccaaggttcatcagttggtgttagccatgtaactaacgctgatgaatatgcagca
gcattaaaagaagcatttaagtacgatgacaaggtattagttgaaaaaactgttcctggt
actgaagtagaaactgccgtacttggtaacgacaagccaattgtagcaggtgtgggacaa
atcaccaatgcaaaaggctcattctacagctataagaacaaatacgatgacaattcaact
tctaagttacaaatccctgcagatttgccacaagaaattattgacaccgtaagaagaaat
gctcgtaaagtttatgaagttaccgaatgtagtggtatggctagaattgactctatgctt
actccaggtggtaaagtagtattgactgaagttaatgctcttccaggctttactaatatc
agtatgtatcctaagttgtttgaagaagcaggtgttccttacactgagttaattactcgt
ttgattgaagtaggaatggaacgttttgaccataagaagactttgcttcataagcacgat
taa

DBGET integrated database retrieval system