KEGG   Lactobacillus helveticus R0052: R0052_04350Help
Entry
R0052_04350       CDS       T02217                                 

Definition
(GenBank) hypothetical protein
Organism
lhr  Lactobacillus helveticus R0052
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF2207 APG9 P2_N DUF973
Motif
Other DBs
NCBI-ProteinID: AFR21770
LinkDB All DBs
Position
754003..755799
Genome map
AA seq 598 aa AA seqDB search
MKRKLLSLIGIFSLISIFAMWAQPVKANVDYDITDMNVTAKVNRNGSVMIHRKIYYDFDS
DARGVYYRQNLTQKQKIKDIQVKVNDQPVIAANNKKNNTYQLTKENNSYRFKVFHRISED
NRIKVEYSYKILDLITNYKDTAELNFKIIGNGWDTDIDHAQATVVFPESVEGLKAWAHGS
LDGYTQVLPHKGKIIMKADDVAGDVGIEVHAIFPTAVTAANKNYVDQNKKEAIEKQEAQL
AREANERRKRKLYFGWGLAFVSLITGLVVIVKGFFGKKMGFKPKKQGELAHNYEIPNVDP
VTAQILDNAAWPDTKALTAYLMQLAAKKKIKIEEFKTKHLKKTNYCISLVDKSILQDDLL
YFLFNQVGDRKSFTTKELRNYTSRKLGKKFDNWCKRKYKQTEQAGFLDHELEIARSHYRT
LAIVGIMISIAAWIIAIFQLGPSMASVVIGGILLIVIEFIAFFVGNHKISLYTQKGALET
DQVRGFEKMLDDIGRFKMKDVGDLILWEDIMPYAVAFGLSKKVLKQLKLEFTQDELDATG
FIVGSSFYSTGSDGFERNFTSSFSEGVSYGSSSASGGSGGFSGGSSGGVGGGSGGGAF
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaaacttttaagtttaattgggatatttagtttaataagtatttttgcaatg
tgggctcaacctgtaaaagccaatgttgattatgatattactgacatgaatgttaccgca
aaagttaatcgtaatggttcagtaatgattcaccggaagatttattatgattttgatagt
gatgcgcgcggtgtatactatcggcaaaatttgacgcaaaaacaaaaaattaaggatatt
caagtaaaagtaaatgatcaaccagttattgccgcaaataataagaaaaataacacttat
cagctaactaaagaaaataattcttatcgttttaaggtttttcatcgaatttctgaagat
aatcggattaaagttgaatattcctacaaaattttagatttaattactaattataaagat
actgctgaattgaattttaaaattataggtaatggttgggatactgatattgatcatgcg
caagctacggttgtttttcctgaatcagtagaaggattaaaagcttgggcacatggttct
ttagatggttatacccaggttttaccgcacaaaggcaaaattattatgaaggcagacgat
gtggctggtgatgttggcatcgaagtacatgcgattttccctacagctgtcacggccgca
aataaaaattatgttgatcaaaataaaaaagaagcaattgaaaaacaagaggcccaatta
gctagagaagctaatgagagaagaaaaagaaaattatactttggctggggcttagctttt
gtatctttgattactggcttagtggttattgttaaaggattctttggtaagaaaatgggc
tttaaacctaagaaacagggagaacttgcccataattatgaaattcctaatgtagatcca
gtgactgctcaaattttagataatgctgcttggccagataccaaggcacttacagcatat
ttgatgcaacttgctgctaaaaagaaaatcaaaattgaagaattcaaaactaagcattta
aagaagacaaattattgcatttctctggtagataaaagtattttgcaggatgatttgctg
tatttcttattcaatcaggttggtgatagaaagtcttttacaaccaaggaattaagaaat
tacacttccagaaaattaggtaagaaatttgataattggtgcaagagaaaatacaagcag
actgaacaagctggctttttagatcatgaattagaaatagctagaagtcattaccgtact
ttagctattgtaggaattatgattagtattgctgcctggattattgcaatttttcaactt
gggccatctatggctagcgttgtgattggtggaattttattaattgtcatagaattcatt
gccttctttgtcggtaatcataaaattagcttgtatactcaaaaaggtgcattagaaact
gatcaagttcgtggatttgaaaagatgcttgatgatattggtagattcaagatgaaagat
gtcggcgatctgattttgtgggaagatattatgccatatgccgttgccttcggcttgtca
aaaaaggttttgaagcaattgaaacttgaatttactcaagatgaattagatgcgacagga
tttattgtggggagttctttctatagcacaggcagtgatggctttgaaagaaactttacc
agcagtttttctgaaggagtatcttatggctcttcttctgcatcaggtggtagcggtggc
ttttcaggcggctcctccggtggtgtaggtggcggaagcggcggtggtgctttttaa

DBGET integrated database retrieval system