KEGG   Lactobacillus helveticus R0052: R0052_10995Help
Entry
R0052_10995       CDS       T02217                                 

Definition
(GenBank) biotin carboxylase
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
lhr  Lactobacillus helveticus R0052
Pathway
lhr00061  Fatty acid biosynthesis
lhr00620  Pyruvate metabolism
lhr00640  Propanoate metabolism
lhr01100  Metabolic pathways
lhr01110  Biosynthesis of secondary metabolites
lhr01120  Microbial metabolism in diverse environments
lhr01130  Biosynthesis of antibiotics
lhr01200  Carbon metabolism
lhr01212  Fatty acid metabolism
Module
lhr_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:lhr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    R0052_10995
   00640 Propanoate metabolism
    R0052_10995
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    R0052_10995
Enzymes [BR:lhr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     R0052_10995
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     R0052_10995
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 ATP-grasp_5 ATP-grasp_4 ATPgrasp_ST DarA_N ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AFR22891
LinkDB All DBs
Position
complement(1946049..1947428)
Genome map
AA seq 459 aa AA seqDB search
MFKKVLVANRGEIAVQIIRALHDMGITAVAVYSSADKDSLFVHLADEAICIGGPQPSESY
LNMAQIISAANLTGCEAIHPGYGFLSENAEFAELCETCHIKFVGPSHELISLMGDKSNAR
EAMEKAGVPVIPGSQGVVKTVSQAETVAEKIGFPVLLKAAAGGGGKGIREVDRPEDLHSA
FEQTQQEARVSFNNDDIYVEKLIRNAKHVEMQVIADEFNHVVYLPERDCSLQRNHQKVIE
ESPCVQISPTERKKLGEIVANATLKLGYTNTGTYEFLMTEDHHFYFMEMNTRLQVEHTIT
EEVTGIELVKAQLKVADGQELPFTQADVAVKGHALECRLNAEDPSHNFAPRPGRINHLFF
PAGSLGVRIDSGVAQGSFISPFYDSMIAKVVVHLNDRNTVIAKMNRILEELKINGVVTNQ
TFLKYLINTAEFNSGQYSTNFIENQVLTNKEGFHVAESV
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaaaagtattagtggctaatcgtggtgaaattgccgtccaaattattcgggca
ctgcacgatatgggcatcacggcggtagcagtctattctagtgctgataaagacagtttg
ttcgttcacttagctgatgaggcaatctgtattggtgggccacaaccgagcgagtcgtat
ctcaatatggctcaaatcattagtgctgctaacctgactgggtgtgaagcaattcatcct
ggctacggattcttgtcagagaacgccgaatttgcggaactctgcgaaacctgtcatatc
aagtttgtcggtcccagtcacgaattgatttcgctgatgggtgataaatcaaatgccaga
gaagccatggaaaaagctggcgtgccagtaattcctggtagccagggagttgtcaaaaca
gtcagccaagcagaaacagttgcagaaaaaattggcttcccagtcttattgaaggcagct
gcaggtggcggtggtaagggaattcgtgaggttgatcgaccagaagatcttcatagtgcc
ttcgagcagactcaacaagaagcccgggtatcgttcaacaacgatgatatttatgtcgaa
aaattgattcgaaatgccaaacacgtcgaaatgcaagtcattgccgatgaatttaaccac
gtggtctatctgccagagcgggattgttcccttcagcggaaccaccaaaaggtgatcgag
gaaagcccctgtgtccagatttcaccgactgaacggaaaaaattgggcgaaattgttgcc
aatgcaactttaaaattaggctataccaatacagggacctatgaattcttgatgaccgaa
gaccaccacttttacttcatggaaatgaacaccagacttcaagttgagcacacgattacc
gaagaagtgaccggtatcgaattggttaaagcccagctgaaggttgctgatgggcaagag
ttgccatttacgcaagcagatgtagccgtaaagggacatgcccttgagtgtcgtctcaac
gccgaagatcctagtcataacttcgctccccgaccaggtcggattaatcatttgttcttt
ccggctgggtcactcggagttcgaattgattccggggtcgcccagggaagctttatttca
ccattctatgattcaatgattgccaaagtggtcgttcatttgaatgatcggaataccgta
attgccaagatgaatcgaattctagaggaactcaagatcaatggggtagtgactaatcaa
accttcttaaagtatttgattaacactgctgaatttaattccggccagtattcaaccaac
tttatcgagaatcaggttttaacgaacaaggagggattccatgttgcagagtcggtttaa

DBGET integrated database retrieval system