KEGG   Linepithema humile (Argentine ant): 105667913
Entry
105667913         CDS       T04898                                 

Definition
(RefSeq) fibroblast growth factor 9-like
  KO
K18496  fibroblast growth factor 1
Organism
lhu  Linepithema humile (Argentine ant)
Brite
KEGG Orthology (KO) [BR:lhu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:lhu04052]
    105667913
   00536 Glycosaminoglycan binding proteins [BR:lhu00536]
    105667913
Cytokines and growth factors [BR:lhu04052]
 Growth factors
  Growth factors (RTK binding)
   105667913
Glycosaminoglycan binding proteins [BR:lhu00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   105667913
SSDB
Motif
Pfam: FGF
Other DBs
NCBI-GeneID: 105667913
NCBI-ProteinID: XP_012215461
LinkDB
Position
Unknown
AA seq 238 aa
MSLRWIHENLEPPTVDEECSDIDDSCSDDSYATDLSLHEDDNITTENGKGIIRDGRKKRE
TKRPPTVTVTFDGTPRNIQRNSKSRKYSPCVIWDPRQPAKNPAYNCQVIKLYCRTGYHLA
ITPSGRVRGLSGNNESHALLHVTPVSFGVIRIQSVETRLYLAFNKKGRLYGEINMNNDNT
EWEQWSIGSYDAFRSRKYVYYGWWIGIKKNGRAKSGAKTSWGQKAIQFSAIQENESIN
NT seq 717 nt   +upstreamnt  +downstreamnt
atgagtttgcgctggattcatgagaatctcgaaccaccaacggtcgacgaagagtgcagc
gatattgatgatagttgcagcgacgatagttacgctacagatttgtcccttcacgaggat
gacaacataacgacggagaacgggaaaggaattattcgcgacggccggaagaagagagaa
accaagagacctccgactgtaaccgtcacttttgatgggacgccgcgtaacattcaacgt
aattctaaatcacggaagtactcgccctgcgtgatatgggatccccgacagccagcgaaa
aaccccgcctacaattgtcaggtaataaaactgtactgccgaaccgggtatcatctggca
attacaccgtcaggacgagttcgaggattatccggcaacaatgagtcgcacgctctgctt
cacgtgacgccggtgtcttttggcgttatcaggatacaaagtgtcgaaacaaggctctac
ttggcattcaataagaaaggacgattatatggagagataaatatgaataatgacaatact
gagtgggaacaatggagtattggctcctacgatgcgtttcgatcacgcaaatatgtatat
tatggatggtggataggaataaaaaagaatgggcgagcaaaatcaggagcgaaaacgtct
tggggacaaaaggcgatacaattttcagctattcaagagaatgaatcaattaactag

DBGET integrated database retrieval system